KEGG   Homo sapiens (human): 133418
Entry
133418            CDS       T01001                                 
Symbol
EMB, GP70
Name
(RefSeq) embigin
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: I-set Ig_3 Ig_2 ig C1-set V-set C2-set_2
Other DBs
NCBI-GeneID: 133418
NCBI-ProteinID: NP_940851
OMIM: 615669
HGNC: 30465
Ensembl: ENSG00000170571
Pharos: Q6PCB8(Tdark)
UniProt: Q6PCB8
Position
5:complement(50396192..50443345)
AA seq 327 aa
MRALPGLLEARARTPRLLLLQCLLAAARPSSADGSAPDSPFTSPPLREEIMANNFSLESH
NISLTEHSSMPVEKNITLERPSNVNLTCQFTTSGDLNAVNVTWKKDGEQLENNYLVSATG
STLYTQYRFTIINSKQMGSYSCFFREEKEQRGTFNFKVPELHGKNKPLISYVGDSTVLTC
KCQNCFPLNWTWYSSNGSVKVPVGVQMNKYVINGTYANETKLKITQLLEEDGESYWCRAL
FQLGESEEHIELVVLSYLVPLKPFLVIVAEVILLVATILLCEKYTQKKKKHSDEGKEFEQ
IEQLKSDDSNGIENNVPRHRKNESLGQ
NT seq 984 nt   +upstreamnt  +downstreamnt
atgcgcgccctccccggcctgctggaggccagggcgcgtacgccccggctgctcctcctc
cagtgccttctcgctgccgcgcgcccaagctcggcggacggcagtgccccagattcgcct
tttacaagtccacctctcagagaagaaataatggcaaataacttttccttggagagtcat
aacatatcactgactgaacattctagtatgccagtagaaaaaaatatcactttagaaagg
ccttctaatgtaaatctcacatgccagttcacaacatctggggatttgaatgcagtaaat
gtgacttggaaaaaagatggtgaacaacttgagaataattatcttgtcagtgcaacagga
agcaccttgtatacccaatacaggttcaccatcattaatagcaaacaaatgggaagttat
tcttgtttctttcgagaggaaaaggaacaaaggggaacatttaatttcaaagtccctgaa
cttcatgggaaaaacaagccattgatctcttacgtaggggattctactgtcttgacatgt
aaatgtcaaaattgttttcctttaaattggacctggtacagtagtaatgggagtgtaaag
gttcctgttggtgttcaaatgaataaatatgtgatcaatggaacatatgctaacgaaaca
aagctgaagataacacaacttttggaggaagatggggaatcttactggtgccgtgcacta
ttccaattaggcgagagtgaagaacacattgagcttgtggtgctgagctatttggtgccc
ctcaaaccatttcttgtaatagtggctgaggtgattcttttagtggccaccattctgctt
tgtgaaaagtacacacaaaagaaaaagaagcactcagatgaggggaaagaatttgagcag
attgaacagctgaaatcagatgatagcaatggtatagaaaataatgtccccaggcataga
aaaaatgagtctctgggccagtga

DBGET integrated database retrieval system