KEGG   Homo sapiens (human): 133686
Entry
133686            CDS       T01001                                 

Gene name
NADK2, C5orf33, DECRD, MNADK, NADKD1
Definition
(RefSeq) NAD kinase 2, mitochondrial
  KO
K00858  NAD+ kinase [EC:2.7.1.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
Disease
H00525  Disorders of mitochondrial fatty-acid oxidation
H01929  2,4-Dienoyl-CoA reductase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    133686 (NADK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.23  NAD+ kinase
     133686 (NADK2)
SSDB
Motif
Pfam: NAD_kinase DAGK_cat TPALS
Other DBs
NCBI-GeneID: 133686
NCBI-ProteinID: NP_001078880
OMIM: 615787
HGNC: 26404
Ensembl: ENSG00000152620
Vega: OTTHUMG00000131105
Pharos: Q4G0N4(Tbio)
UniProt: Q4G0N4
Position
5p13.2
AA seq 442 aa
MTCYRGFLLGSCCRVAGGRAAALRGPGAGGPAARPRLGGDGGGRRHLGQGQPRELAGCGS
RADGGFRPSRVVVVAKTTRYEFEQQRYRYAELSEEDLKQLLALKGSSYSGLLERHHIHTK
NVEHIIDSLRNEGIEVRLVKRREYDEETVRWADAVIAAGGDGTMLLAASKVLDRLKPVIG
VNTDPERSEGHLCLPVRYTHSFPEALQKFYRGEFRWLWRQRIRLYLEGTGINPVPVDLHE
QQLSLNQHNRALNIERAHDERSEASGPQLLPVRALNEVFIGESLSSRASYYEISVDDGPW
EKQKSSGLNLCTGTGSKAWSFNINRVATQAVEDVLNIAKRQGNLSLPLNRELVEKVTNEY
NESLLYSPEEPKILFSIREPIANRVFSSSRQRCFSSKVCVRSRCWDACMVVDGGTSFEFN
DGAIASMMINKEDELRTVLLEQ
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgacttgctaccgaggcttcttgctgggcagctgttgtcgcgtggcgggcggccgggcg
gcggcgctgcggggaccgggtgcgggaggccccgccgcgcggccccggctgggcggtgac
ggtggcggccggcggcacctggggcaggggcagccgcgcgagctggcgggctgtggcagc
cgcgcggacggcggcttccgcccctcccgggtggtggtggtggccaaaaccacccggtac
gagttcgagcagcagcggtaccgttacgcggagctctcggaggaggacctgaagcagctg
cttgcattgaaaggctctagttacagtggacttcttgaacgacatcatattcacaccaaa
aatgtagaacatattatagatagtttacggaatgagggaattgaggttcgtctagtaaag
aggagagaatatgatgaagagactgttcgatgggcagatgctgtcatagctgcaggaggt
gatggcacaatgctgctggcagcgagtaaagtcttggacagacttaaaccagttataggg
gtaaacactgatccagaacggtctgagggtcatttatgcctgcccgttcgatatacacat
tcctttccagaagccttacagaagttctatcgtggtgagttcaggtggttgtggaggcag
agaatcaggttataccttgaagggactggcataaaccctgtacctgtggaccttcacgag
cagcagctaagcttgaatcagcacaatagagcccttaacattgaaagagctcatgatgaa
aggtctgaggcttcaggaccccaacttctgccagtgagagcactaaatgaagtcttcatt
ggggagagtctgtcatccagggcttcctactatgagatttcagttgatgatggtccatgg
gaaaaacagaagagttcagggctcaatttgtgtactggaacaggatcaaaggcctggtca
ttcaatattaacagggttgcaactcaggctgtagaagatgttttaaatattgcaaaacga
caaggaaatttgagtcttccattgaacagagaattggtagagaaagtaacaaatgaatat
aatgaatcactgctctacagtccggaagaaccaaaaatacttttcagtattcgagaacca
atagcaaatagagttttctcaagcagtcgtcagcgttgtttctcctcaaaggtttgtgtt
cgttctcgttgttgggatgcctgtatggttgtggatggaggaacttcttttgagtttaat
gatggtgcaattgcttcgatgatgatcaataaagaagatgagcttcgaactgtgcttctt
gaacagtga

DBGET integrated database retrieval system