KEGG   Homo sapiens (human): 133957
Entry
133957            CDS       T01001                                 
Symbol
CCDC127
Name
(RefSeq) coiled-coil domain containing 127
Organism
hsa  Homo sapiens (human)
SSDB
Other DBs
NCBI-GeneID: 133957
NCBI-ProteinID: NP_660308
HGNC: 30520
Ensembl: ENSG00000164366
Pharos: Q96BQ5(Tdark)
UniProt: Q96BQ5
Position
5:complement(196868..218153)
AA seq 260 aa
MNNLNDPPNWNIRPNSRADGGDGSRWNYALLVPMLGLAAFRWIWSRESQKEVEKEREAYR
RRTAAFQQDLEAKYHAMISENRRAVAQLSLELEKEQNRTASYREALISQGRKLVEEKKLL
EQERAQVMQEKRQVQPLRSAYLSCLQREENWQRRARLLLKEFEAVLTERQNIYCSLFLPR
SKRLEIEKSLLVRASVDPVAADLEMAAGLTDIFQHDTYCGDVWNTNKRQNGRLMWLYLKY
WELVVELKKFKRVEEAILEK
NT seq 783 nt   +upstreamnt  +downstreamnt
atgaataacctaaatgatcccccaaattggaatatccggcctaattccagggcggatggt
ggtgatggaagcaggtggaattatgccctgttggttccaatgctgggattggctgctttt
cgttggatttggtctagggagtcccagaaagaagtagaaaaagagagagaagcctaccgt
cggagaactgctgcttttcaacaggatctggaagccaagtaccacgccatgatctcagaa
aatcggcgtgctgtcgctcagttgtccttggaactcgaaaaggaacaaaacagaactgct
agttaccgagaagcccttatctctcagggacgcaagttggtagaagaaaagaagcttctg
gaacaggaacgggcccaggtgatgcaagaaaaaagacaggtgcagcctttgagaagtgcg
tatttgagctgcctgcaaagggaagaaaactggcaaaggagagccaggcttttgctgaaa
gaatttgaagctgttctcacagaaagacagaatatctactgcagtctgtttcttcctcgc
agcaagcggctggagatagagaagagcttactggtgcgagcgtccgtcgaccccgtcgcc
gctgacctagagatggcagccggtctcaccgacatatttcagcatgatacatactgtggt
gatgtctggaacaccaacaaacgccagaatggcagactcatgtggctctatctcaaatac
tgggaactcgttgtcgaactgaagaagtttaagagagtagaggaagccatactagaaaag
taa

DBGET integrated database retrieval system