KEGG   Homo sapiens (human): 134Help
Entry
134               CDS       T01001                                 

Gene name
ADORA1, RDC7
Definition
(RefSeq) adenosine A1 receptor
  KO
K04265  adenosine receptor A1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa05032  Morphine addiction
Drug target
Adenosine (DG00243): D00045 D02300 D02769 D08646 D08647
Aminophylline (DG01062): D00227 D05429 D11630
Apaxifylline: D02964
Bamifylline (DG01064): D03051 D07491
Caffeine (DG00974): D00528 D01453 D07603
Choline theophyllinate: D02017
Diprophylline: D00691
Enprofylline: D04006
Naxifylline: D05125
Proxyphylline: D01771
Rolofylline: D08989
Selodenoson: D05818
Tecadenoson: D06019
Theophylline (DG01061): D00371 D01712 D06103 D06104
Tonapofylline: D09684
Trabodenoson: D10493
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    134 (ADORA1)
   04024 cAMP signaling pathway
    134 (ADORA1)
   04022 cGMP-PKG signaling pathway
    134 (ADORA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    134 (ADORA1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    134 (ADORA1)
   04924 Renin secretion
    134 (ADORA1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    134 (ADORA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    134 (ADORA1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    134 (ADORA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx CcmH
Motif
Other DBs
NCBI-GeneID: 134
NCBI-ProteinID: NP_000665
OMIM: 102775
HGNC: 262
Ensembl: ENSG00000163485
Vega: OTTHUMG00000042125
Pharos: P30542(Tclin)
UniProt: P30542
Structure
PDB: 

Position
1q32.1
AA seq 326 aa AA seqDB search
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctccatctcagctttccaggccgcctacatcggcatcgaggtgctcatcgcc
ctggtctctgtgcccgggaacgtgctggtgatctgggcggtgaaggtgaaccaggcgctg
cgggatgccaccttctgcttcatcgtgtcgctggcggtggctgatgtggccgtgggtgcc
ctggtcatccccctcgccatcctcatcaacattgggccacagacctacttccacacctgc
ctcatggttgcctgtccggtcctcatcctcacccagagctccatcctggccctgctggca
attgctgtggaccgctacctccgggtcaagatccctctccggtacaagatggtggtgacc
ccccggagggcggcggtggccatagccggctgctggatcctctccttcgtggtgggactg
acccctatgtttggctggaacaatctgagtgcggtggagcgggcctgggcagccaacggc
agcatgggggagcccgtgatcaagtgcgagttcgagaaggtcatcagcatggagtacatg
gtctacttcaacttctttgtgtgggtgctgcccccgcttctcctcatggtcctcatctac
ctggaggtcttctacctaatccgcaagcagctcaacaagaaggtgtcggcctcctccggc
gacccgcagaagtactatgggaaggagctgaagatcgccaagtcgctggccctcatcctc
ttcctctttgccctcagctggctgcctttgcacatcctcaactgcatcaccctcttctgc
ccgtcctgccacaagcccagcatccttacctacattgccatcttcctcacgcacggcaac
tcggccatgaaccccattgtctatgccttccgcatccagaagttccgcgtcaccttcctt
aagatttggaatgaccatttccgctgccagcctgcacctcccattgacgaggatctccca
gaagagaggcctgatgactag

KEGG   Homo sapiens (human): 135Help
Entry
135               CDS       T01001                                 

Gene name
ADORA2A, A2aR, ADORA2, RDC8
Definition
(RefSeq) adenosine A2a receptor
  KO
K04266  adenosine receptor A2a
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
hsa05012  Parkinson disease
hsa05034  Alcoholism
Drug target
Adenosine (DG00243): D00045 D02300 D02769 D08646 D08647
Apadenoson: D03212
Binodenoson: D03120
Caffeine (DG00974): D00528 D01453 D07603
Choline theophyllinate: D02017
Ciforadenant: D11547
Doxofylline: D03898
Enprofylline: D04006
Evodenoson: D10362
Istradefylline: D04641
Preladenant: D09717
Proxyphylline: D01771
Regadenoson: D05711
Sonedenoson: D09003
Tozadenant: D10174
Vipadenant: D09991
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    135 (ADORA2A)
   04020 Calcium signaling pathway
    135 (ADORA2A)
   04024 cAMP signaling pathway
    135 (ADORA2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    135 (ADORA2A)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    135 (ADORA2A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    135 (ADORA2A)
  09165 Substance dependence
   05034 Alcoholism
    135 (ADORA2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    135 (ADORA2A)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    135 (ADORA2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx GPR_Gpa2_C Ni_hydr_CYTB
Motif
Other DBs
NCBI-GeneID: 135
NCBI-ProteinID: NP_000666
OMIM: 102776
HGNC: 263
Ensembl: ENSG00000128271
Vega: OTTHUMG00000150761
Pharos: P29274(Tclin)
UniProt: P29274 B3KVQ4 X5DNB4
Structure
PDB: 

Position
22q11.23
AA seq 412 aa AA seqDB search
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcatgggctcctcggtgtacatcacggtggagctggccattgctgtgctggcc
atcctgggcaatgtgctggtgtgctgggccgtgtggctcaacagcaacctgcagaacgtc
accaactactttgtggtgtcactggcggcggccgacatcgcagtgggtgtgctcgccatc
ccctttgccatcaccatcagcaccgggttctgcgctgcctgccacggctgcctcttcatt
gcctgcttcgtcctggtcctcacgcagagctccatcttcagtctcctggccatcgccatt
gaccgctacattgccatccgcatcccgctccggtacaatggcttggtgaccggcacgagg
gctaagggcatcattgccatctgctgggtgctgtcgtttgccatcggcctgactcccatg
ctaggttggaacaactgcggtcagccaaaggagggcaagaaccactcccagggctgcggg
gagggccaagtggcctgtctctttgaggatgtggtccccatgaactacatggtgtacttc
aacttctttgcctgtgtgctggtgcccctgctgctcatgctgggtgtctatttgcggatc
ttcctggcggcgcgacgacagctgaagcagatggagagccagcctctgccgggggagcgg
gcacggtccacactgcagaaggaggtccatgctgccaagtcactggccatcattgtgggg
ctctttgccctctgctggctgcccctacacatcatcaactgcttcactttcttctgcccc
gactgcagccacgcccctctctggctcatgtacctggccatcgtcctctcccacaccaat
tcggttgtgaatcccttcatctacgcctaccgtatccgcgagttccgccagaccttccgc
aagatcattcgcagccacgtcctgaggcagcaagaacctttcaaggcagctggcaccagt
gcccgggtcttggcagctcatggcagtgacggagagcaggtcagcctccgtctcaacggc
cacccgccaggagtgtgggccaacggcagtgctccccaccctgagcggaggcccaatggc
tatgccctggggctggtgagtggagggagtgcccaagagtcccaggggaacacgggcctc
ccagacgtggagctccttagccatgagctcaagggagtgtgcccagagccccctggccta
gatgaccccctggcccaggatggagcaggagtgtcctga

KEGG   Homo sapiens (human): 136Help
Entry
136               CDS       T01001                                 

Gene name
ADORA2B, ADORA2
Definition
(RefSeq) adenosine A2b receptor
  KO
K04267  adenosine receptor A2b
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
hsa05034  Alcoholism
Drug target
Adenosine (DG00243): D00045 D02300 D02769 D08646 D08647
Aminophylline (DG01062): D00227 D05429 D11630
Diprophylline: D00691
Enprofylline: D04006
Proxyphylline: D01771
Theophylline (DG01061): D00371 D01712 D06103 D06104
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    136 (ADORA2B)
   04020 Calcium signaling pathway
    136 (ADORA2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    136 (ADORA2B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    136 (ADORA2B)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    136 (ADORA2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    136 (ADORA2B)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    136 (ADORA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx GPR_Gpa2_C 7TM_GPCR_Sri
Motif
Other DBs
NCBI-GeneID: 136
NCBI-ProteinID: NP_000667
OMIM: 600446
HGNC: 264
Ensembl: ENSG00000170425
Vega: OTTHUMG00000059140
Pharos: P29275(Tclin)
UniProt: P29275
Position
17p12
AA seq 332 aa AA seqDB search
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggagacacaggacgcgctgtacgtggcgctggagctggtcatcgccgcgctt
tcggtggcgggcaacgtgctggtgtgcgccgcggtgggcacggcgaacactctgcagacg
cccaccaactacttcctggtgtccctggctgcggccgacgtggccgtggggctcttcgcc
atcccctttgccatcaccatcagcctgggcttctgcactgacttctacggctgcctcttc
ctcgcctgcttcgtgctggtgctcacgcagagctccatcttcagccttctggccgtggca
gtcgacagatacctggccatctgtgtcccgctcaggtataaaagtttggtcacggggacc
cgagcaagaggggtcattgctgtcctctgggtccttgcctttggcatcggattgactcca
ttcctggggtggaacagtaaagacagtgccaccaacaactgcacagaaccctgggatgga
accacgaatgaaagctgctgccttgtgaagtgtctctttgagaatgtggtccccatgagc
tacatggtatatttcaatttctttgggtgtgttctgcccccactgcttataatgctggtg
atctacattaagatcttcctggtggcctgcaggcagcttcagcgcactgagctgatggac
cactcgaggaccaccctccagcgggagatccatgcagccaagtcactggccatgattgtg
gggatttttgccctgtgctggttacctgtgcatgctgttaactgtgtcactcttttccag
ccagctcagggtaaaaataagcccaagtgggcaatgaatatggccattcttctgtcacat
gccaattcagttgtcaatcccattgtctatgcttaccggaaccgagacttccgctacact
tttcacaaaattatctccaggtatcttctctgccaagcagatgtcaagagtgggaatggt
caggctggggtacagcctgctctcggtgtgggcctatga

KEGG   Homo sapiens (human): 140Help
Entry
140               CDS       T01001                                 

Gene name
ADORA3, A3AR
Definition
(RefSeq) adenosine A3 receptor
  KO
K04268  adenosine receptor A3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Adenosine (DG00243): D00045 D02300 D02769 D08646 D08647
Namodenoson: D11128
Piclidenoson: D10971
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    140 (ADORA3)
   04022 cGMP-PKG signaling pathway
    140 (ADORA3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    140 (ADORA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    140 (ADORA3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    140 (ADORA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4 7TM_GPCR_Srsx 7TM_GPCR_Srx PapG_N
Motif
Other DBs
NCBI-GeneID: 140
NCBI-ProteinID: NP_000668
OMIM: 600445
HGNC: 268
Ensembl: ENSG00000282608
Vega: OTTHUMG00000011957
Pharos: P0DMS8(Tchem)
UniProt: P0DMS8
Position
1p13.2
AA seq 318 aa AA seqDB search
MPNNSTALSLANVTYITMEIFIGLCAIVGNVLVICVVKLNPSLQTTTFYFIVSLALADIA
VGVLVMPLAIVVSLGITIHFYSCLFMTCLLLIFTHASIMSLLAIAVDRYLRVKLTVRYKR
VTTHRRIWLALGLCWLVSFLVGLTPMFGWNMKLTSEYHRNVTFLSCQFVSVMRMDYMVYF
SFLTWIFIPLVVMCAIYLDIFYIIRNKLSLNLSNSKETGAFYGREFKTAKSLFLVLFLFA
LSWLPLSIINCIIYFNGEVPQLVLYMGILLSHANSMMNPIVYAYKIKKFKETYLLILKAC
VVCHPSDSLDTSIEKNSE
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgcccaacaacagcactgctctgtcattggccaatgttacctacatcaccatggaaatt
ttcattggactctgcgccatagtgggcaacgtgctggtcatctgcgtggtcaagctgaac
cccagcctgcagaccaccaccttctatttcattgtctctctagccctggctgacattgct
gttggggtgctggtcatgcctttggccattgttgtcagcctgggcatcacaatccacttc
tacagctgcctttttatgacttgcctactgcttatctttacccacgcctccatcatgtcc
ttgctggccatcgctgtggaccgatacttgcgggtcaagcttaccgtcagatacaagagg
gtcaccactcacagaagaatatggctggccctgggcctttgctggctggtgtcattcctg
gtgggattgacccccatgtttggctggaacatgaaactgacctcagagtaccacagaaat
gtcaccttcctttcatgccaatttgtttccgtcatgagaatggactacatggtatacttc
agcttcctcacctggattttcatccccctggttgtcatgtgcgccatctatcttgacatc
ttttacatcattcggaacaaactcagtctgaacttatctaactccaaagagacaggtgca
ttttatggacgggagttcaagacggctaagtccttgtttctggttcttttcttgtttgct
ctgtcatggctgcctttatctatcatcaactgcatcatctactttaatggtgaggtacca
cagcttgtgctgtacatgggcatcctgctgtcccatgccaactccatgatgaaccctatc
gtctatgcctataaaataaagaagttcaaggaaacctaccttttgatcctcaaagcttgt
gtggtctgccatccctctgattctttggacacaagcattgagaagaattctgagtag

DBGET integrated database retrieval system