KEGG   Homo sapiens (human): 1340
Entry
1340              CDS       T01001                                 
Symbol
COX6B1, COX6B, COXG, COXVIb1, MC4DN7
Name
(RefSeq) cytochrome c oxidase subunit 6B1
  KO
K02267  cytochrome c oxidase subunit 6b
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
N01394  Arsenic to electron transfer in complex IV
Disease
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1340 (COX6B1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1340 (COX6B1)
  09159 Environmental adaptation
   04714 Thermogenesis
    1340 (COX6B1)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    1340 (COX6B1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1340 (COX6B1)
   05012 Parkinson disease
    1340 (COX6B1)
   05014 Amyotrophic lateral sclerosis
    1340 (COX6B1)
   05016 Huntington disease
    1340 (COX6B1)
   05020 Prion disease
    1340 (COX6B1)
   05022 Pathways of neurodegeneration - multiple diseases
    1340 (COX6B1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1340 (COX6B1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1340 (COX6B1)
SSDB
Motif
Pfam: COX6B CHCH YozE_SAM_like
Other DBs
NCBI-GeneID: 1340
NCBI-ProteinID: NP_001854
OMIM: 124089
HGNC: 2280
Ensembl: ENSG00000126267
Pharos: P14854(Tbio)
UniProt: P14854
Structure
Position
19:35648323..35658782
AA seq 86 aa
MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRV
YQSLCPTSWVTDWDEQRAEGTFPGKI
NT seq 261 nt   +upstreamnt  +downstreamnt
atggcggaagacatggagaccaaaatcaagaactacaagaccgccccttttgacagccgc
ttccccaaccagaaccagactagaaactgctggcagaactacctggacttccaccgctgt
cagaaggcaatgaccgctaaaggaggcgatatctctgtgtgcgaatggtaccagcgtgtg
taccagtccctctgccccacatcctgggtcacagactgggatgagcaacgggctgaaggc
acgtttcccgggaagatctga

DBGET integrated database retrieval system