KEGG   Homo sapiens (human): 134083Help
Entry
134083            CDS       T01001                                 

Gene name
OR2Y1, OR5-2
Definition
(RefSeq) olfactory receptor family 2 subfamily Y member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    134083 (OR2Y1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    134083 (OR2Y1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    134083 (OR2Y1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 134083
NCBI-ProteinID: NP_001001657
HGNC: 14837
Ensembl: ENSG00000174339
Vega: OTTHUMG00000162237
Pharos: Q8NGV0(Tdark)
UniProt: Q8NGV0
Position
5q35.3
AA seq 311 aa AA seqDB search
MGSFNTSFEDGFILVGFSDWPQLEPILFVFIFIFYSLTLFGNTIIIALSWLDLRLHTPMY
FFLSHLSLLDLCFTTSTVPQLLINLCGVDRTITRGGCVAQLFIYLALGSTECVLLVVMAF
DRYAAVCRPLHYMAIMHPHLCQTLAIASWGAGFVNSLIQTGLAMAMPLCGHRLNHFFCEM
PVFLKLACADTEGTEAKMFVARVIVVAVPAALILGSYVHIAHAVLRVKSTAGRRKAFGTC
GSHLLVVFLFYGSAIYTYLQSIHNYSEREGKFVALFYTIITPILNPLIYTLRNKDVKGAL
WKVLWRGRDSG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtttcaacaccagttttgaagatggcttcattttggtgggattctcagattgg
ccgcaactggagcccatcctgtttgtctttatttttattttctactccctaactctcttt
ggcaacaccatcatcatcgctctctcctggctagaccttcggctgcacacacctatgtac
ttctttctctctcatctgtccctcctggacctctgcttcaccaccagcaccgtgccccag
ctcctgatcaacctttgcggggtggaccgcaccatcacccgtggagggtgtgtggctcag
ctcttcatctacctagccctgggctccacagagtgtgtgctcctggtggtgatggccttt
gaccgctatgctgctgtctgtcgtccactccactacatggccatcatgcacccccatctc
tgccagaccctggctatcgcctcctggggtgcgggtttcgtgaactctctgatccagaca
ggtctcgcaatggccatgcctctctgtggccatcgactgaatcacttcttctgtgagatg
cctgtatttctgaagttggcttgtgcggacacagaaggaacagaggccaagatgtttgtg
gcccgagtcatagtcgtggctgttcctgcagcacttattctaggctcctatgtgcacatt
gctcatgcagtgctgagggtgaagtcaacggctgggcgcagaaaggcttttgggacttgt
gggtcccacctcctagtagttttccttttttatggctcagccatctacacatatctccaa
tccatccacaattattctgagcgtgagggaaaatttgttgcccttttttatactataatt
acccccattctcaatcctctcatttatacactaagaaacaaggacgtgaagggggctctg
tggaaagtactatggaggggcagggactcagggtag

DBGET integrated database retrieval system