KEGG   Homo sapiens (human): 134111Help
Entry
134111            CDS       T01001                                 

Gene name
UBE2QL1
Definition
(RefSeq) ubiquitin conjugating enzyme E2 Q family like 1
  KO
K10582  ubiquitin-conjugating enzyme E2 Q [EC:2.3.2.23]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    134111 (UBE2QL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    134111 (UBE2QL1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     134111 (UBE2QL1)
Ubiquitin system [BR:hsa04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   134111 (UBE2QL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UQ_con Prok-E2_B
Motif
Other DBs
NCBI-GeneID: 134111
NCBI-ProteinID: NP_001138633
OMIM: 615832
HGNC: 37269
Ensembl: ENSG00000215218
Vega: OTTHUMG00000161683
Pharos: A1L167(Tbio)
UniProt: A1L167
Position
5p15.31
AA seq 161 aa AA seqDB search
MKELQDIARLSDRFISVELVDESLFDWNVKLHQVDKDSVLWQDMKETNTEFILLNLTFPD
NFPFSPPFMRVLSPRLENGYVLDGGAICMELLTPRGWSSAYTVEAVMRQFAASLVKGQGR
ICRKAGKSKKSFSRKEAEATFKSLVKTHEKYGWVTPPVSDG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagctgcaggacatcgcgcgccttagcgaccgcttcatctccgtggagctggtg
gacgagagcctgttcgactggaacgtgaagctgcaccaggtggacaaggactcggtgctg
tggcaggacatgaaggagaccaacaccgagttcatcctgctcaacctcaccttccccgac
aacttccccttctcgccgcccttcatgcgggtgctcagcccgcgcctggagaacggctac
gtgctggacggcggcgccatctgcatggagctgctcacgccgcgcggctggtccagcgcc
tacaccgtggaggccgtcatgcgccagttcgcagccagcctggtcaagggccagggacgg
atctgtagaaaagctggcaaatcaaaaaagtccttcagtcgcaaggaagctgaagctacc
tttaagagtttggtgaagacgcatgaaaaatatggttgggtcaccccgcccgtgtccgac
ggctga

DBGET integrated database retrieval system