KEGG   Homo sapiens (human): 134147
Entry
134147            CDS       T01001                                 
Symbol
CMBL, JS-1
Name
(RefSeq) carboxymethylenebutenolidase homolog
  KO
K01061  carboxymethylenebutenolidase [EC:3.1.1.45]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01100  Metabolic pathways
Brite
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.45  carboxymethylenebutenolidase
     134147 (CMBL)
SSDB
Motif
Pfam: DLH Peptidase_S9 Abhydrolase_2 DUF915 FSH1 Abhydrolase_1 BAAT_C Abhydrolase_3 PAF-AH_p_II Abhydrolase_5 DUF829
Other DBs
NCBI-GeneID: 134147
NCBI-ProteinID: NP_620164
OMIM: 613379
HGNC: 25090
Ensembl: ENSG00000164237
Pharos: Q96DG6(Tdark)
UniProt: Q96DG6
Position
5:complement(10277595..10307902)
AA seq 245 aa
MANEAYPCPCDIGHRLEYGGLGREVQVEHIKAYVTKSPVDAGKAVIVIQDIFGWQLPNTR
YIADMISGNGYTTIVPDFFVGQEPWDPSGDWSIFPEWLKTRNAQKIDREISAILKYLKQQ
CHAQKIGIVGFCWGGTAVHHLMMKYSEFRAGVSVYGIVKDSEDIYNLKNPTLFIFAENDV
VIPLKDVSLLTQKLKEHCKVEYQIKTFSGQTHGFVHRKREDCSPADKPYIDEARRNLIEW
LNKYM
NT seq 738 nt   +upstreamnt  +downstreamnt
atggctaacgaagcttatccttgtccgtgtgacattggccacagacttgagtatggaggg
ctaggccgtgaagttcaagtcgagcacatcaaggcttatgtcaccaaatcccccgttgat
gcaggcaaagctgtgattgtcattcaagatatatttggctggcagttgcccaataccaga
tatatagctgacatgatctcaggaaatggatacacaaccattgttccagacttctttgta
gggcaagagccttgggacccctctggcgactggtctatcttccctgagtggctgaaaaca
agaaatgcccagaagatcgatagagagatcagtgctatcttgaagtatctgaaacaacag
tgtcatgcccagaaaattggcatcgtgggattctgctggggtggaactgctgtccatcat
ttgatgatgaaatactcagaattcagggcaggggtgtccgtctatggcattgtcaaggat
tctgaagacatttacaatttaaagaaccccactttgttcatttttgctgaaaatgatgtt
gtgattccactcaaggacgtatctttgctgactcagaagttgaaagaacactgcaaagtt
gaatatcaaattaaaacattttctgggcagactcatgggttcgtgcatcggaagagagaa
gattgctcacctgcagacaagccctacattgacgaggccagaaggaatttaattgagtgg
ctgaacaagtacatgtag

DBGET integrated database retrieval system