KEGG   Homo sapiens (human): 1347Help
Entry
1347              CDS       T01001                                 

Gene name
COX7A2, COX7AL, COX7AL1, COXVIIAL, COXVIIa-L, VIIAL
Definition
(RefSeq) cytochrome c oxidase subunit 7A2
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer's disease
hsa05012  Parkinson's disease
hsa05016  Huntington's disease
Module
hsa_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    1347 (COX7A2)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    1347 (COX7A2)
  Environmental adaptation
   04714 Thermogenesis
    1347 (COX7A2)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    1347 (COX7A2)
   05012 Parkinson's disease
    1347 (COX7A2)
   05016 Huntington's disease
    1347 (COX7A2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    1347 (COX7A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX7a Tox-WTIP
Motif
Other DBs
NCBI-GeneID: 1347
NCBI-ProteinID: NP_001856
OMIM: 123996
HGNC: 2288
Ensembl: ENSG00000112695
Vega: OTTHUMG00000015049
Pharos: P14406(Tdark)
UniProt: P14406 H0UI06
Position
6q14.1
AA seq 115 aa AA seqDB search
MHTQDSEVVPVPAWPFSLVVFSCGGCWSVTAKMLRNLLALRQIGQRTISTASRRHFKNKV
PEKQKLFQEDDEIPLYLKGGVADALLYRATMILTVGGTAYAIYELAVASFPKKQE
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgcatacgcaagactcggaggtagttccggttccggcgtggccattttcgttggtggtg
ttcagttgtggcggttgctggtcagtaacagccaagatgctgcggaatctgctggctctt
cgtcagattgggcagaggacgataagcactgcttcccgcaggcattttaaaaataaagtt
ccggagaagcaaaaactgttccaggaggatgatgaaattccactgtatctaaagggtggg
gtagctgatgccctcctgtatagagccaccatgattcttacagttggtggaacagcatat
gccatatatgagctggctgtggcttcatttcccaagaagcaggagtga

DBGET integrated database retrieval system