KEGG   Homo sapiens (human): 134864Help
Entry
134864            CDS       T01001                                 

Gene name
TAAR1, TA1, TAR1, TRAR1
Definition
(RefSeq) trace amine associated receptor 1
  KO
K05051  trace amine associated receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    134864 (TAAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    134864 (TAAR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Trace amine
    134864 (TAAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 134864
NCBI-ProteinID: NP_612200
OMIM: 609333
HGNC: 17734
Ensembl: ENSG00000146399
Vega: OTTHUMG00000015583
Pharos: Q96RJ0(Tclin)
UniProt: Q96RJ0
Position
6q23.2
AA seq 339 aa AA seqDB search
MMPFCHNIINISCVKNNWSNDVRASLYSLMVLIILTTLVGNLIVIVSISHFKQLHTPTNW
LIHSMATVDFLLGCLVMPYSMVRSAEHCWYFGEVFCKIHTSTDIMLSSASIFHLSFISID
RYYAVCDPLRYKAKMNILVICVMIFISWSVPAVFAFGMIFLELNFKGAEEIYYKHVHCRG
GCSVFFSKISGVLTFMTSFYIPGSIMLCVYYRIYLIAKEQARLISDANQKLQIGLEMKNG
ISQSKERKAVKTLGIVMGVFLICWCPFFICTVMDPFLHYIIPPTLNDVLIWFGYLNSTFN
PMVYAFFYPWFRKALKMMLFGKIFQKDSSRCKLFLELSS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatgcccttttgccacaatataattaatatttcctgtgtgaaaaacaactggtcaaat
gatgtccgtgcttccctgtacagtttaatggtgctcataattctgaccacactcgttggc
aatctgatagttattgtttctatatcacacttcaaacaacttcataccccaacaaattgg
ctcattcattccatggccactgtggactttcttctggggtgtctggtcatgccttacagt
atggtgagatctgctgagcactgttggtattttggagaagtcttctgtaaaattcacaca
agcaccgacattatgctgagctcagcctccattttccatttgtctttcatctccattgac
cgctactatgctgtgtgtgatccactgagatataaagccaagatgaatatcttggttatt
tgtgtgatgatcttcattagttggagtgtccctgctgtttttgcatttggaatgatcttt
ctggagctaaacttcaaaggcgctgaagagatatattacaaacatgttcactgcagagga
ggttgctctgtcttctttagcaaaatatctggggtactgacctttatgacttctttttat
atacctggatctattatgttatgtgtctattacagaatatatcttatcgctaaagaacag
gcaagattaattagtgatgccaatcagaagctccaaattggattggaaatgaaaaatgga
atttcacaaagcaaagaaaggaaagctgtgaagacattggggattgtgatgggagttttc
ctaatatgctggtgccctttctttatctgtacagtcatggacccttttcttcactacatt
attccacctactttgaatgatgtattgatttggtttggctacttgaactctacatttaat
ccaatggtttatgcatttttctatccttggtttagaaaagcactgaagatgatgctgttt
ggtaaaattttccaaaaagattcatccaggtgtaaattatttttggaattgagttcatag

DBGET integrated database retrieval system