KEGG   Homo sapiens (human): 1349
Entry
1349              CDS       T01001                                 
Symbol
COX7B, APLCC, LSDMCA2
Name
(RefSeq) cytochrome c oxidase subunit 7B
  KO
K02271  cytochrome c oxidase subunit 7b
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05208  Chemical carcinogenesis - reactive oxygen species
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06252  Mitochondrial ROS formation
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
N01394  Arsenic to electron transfer in complex IV
Disease
H01904  Microphthalmia with linear skin defects syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1349 (COX7B)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1349 (COX7B)
  09159 Environmental adaptation
   04714 Thermogenesis
    1349 (COX7B)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    1349 (COX7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1349 (COX7B)
   05012 Parkinson disease
    1349 (COX7B)
   05014 Amyotrophic lateral sclerosis
    1349 (COX7B)
   05016 Huntington disease
    1349 (COX7B)
   05020 Prion disease
    1349 (COX7B)
   05022 Pathways of neurodegeneration - multiple diseases
    1349 (COX7B)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1349 (COX7B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1349 (COX7B)
SSDB
Motif
Pfam: COX7B Deltameth_res
Other DBs
NCBI-GeneID: 1349
NCBI-ProteinID: NP_001857
OMIM: 300885
HGNC: 2291
Ensembl: ENSG00000131174
Pharos: P24311(Tbio)
UniProt: P24311
Structure
Position
X:77899468..77907376
AA seq 80 aa
MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCIVTWTYVATQV
GIEWNLSPVGRVTPKEWRNQ
NT seq 243 nt   +upstreamnt  +downstreamnt
atgtttcccttggtcaaaagcgcactaaatcgtctccaagttcgaagcattcagcaaaca
atggcaaggcagagccaccagaaacgtacacctgattttcatgacaaatacggtaatgct
gtattagctagtggagccactttctgtattgttacatggacatatgtagcaacacaagtc
ggaatagaatggaacctgtcccctgttggcagagttaccccaaaggaatggaggaatcag
taa

DBGET integrated database retrieval system