KEGG   Homo sapiens (human): 134957Help
Entry
134957            CDS       T01001                                 

Gene name
STXBP5, LGL3, LLGL3, Nbla04300
Definition
(RefSeq) syntaxin binding protein 5
  KO
K08518  syntaxin-binding protein 5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    134957 (STXBP5)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    134957 (STXBP5)
 SNARE
  VAMP, Ykt6, Sec22 (R)
   Tomosyn
    134957 (STXBP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LLGL ANAPC4_WD40 WD40 Lgl_C Synaptobrevin Frtz WD40_like
Motif
Other DBs
NCBI-GeneID: 134957
NCBI-ProteinID: NP_001121187
OMIM: 604586
HGNC: 19665
Ensembl: ENSG00000164506
Vega: OTTHUMG00000015766
Pharos: Q5T5C0(Tbio)
UniProt: Q5T5C0
Position
6q24.3
AA seq 1151 aa AA seqDB search
MRKFNIRKVLDGLTAGSSSASQQQQQQHPPGNREPEIQETLQSEHFQLCKTVRHGFPYQP
SALAFDPVQKILAVGTQTGALRLFGRPGVECYCQHDSGAAVIQLQFLINEGALVSALADD
TLHLWNLRQKRPAILHSLKFCRERVTFCHLPFQSKWLYVGTERGNIHIVNVESFTLSGYV
IMWNKAIELSSKSHPGPVVHISDNPMDEGKLLIGFESGTVVLWDLKSKKADYRYTYDEAI
HSVAWHHEGKQFICSHSDGTLTIWNVRSPAKPVQTITPHGKQLKDGKKPEPCKPILKVEF
KTTRSGEPFIILSGGLSYDTVGRRPCLTVMHGKSTAVLEMDYSIVDFLTLCETPYPNDFQ
EPYAVVVLLEKDLVLIDLAQNGYPIFENPYPLSIHESPVTCCEYFADCPVDLIPALYSVG
ARQKRQGYSKKEWPINGGNWGLGAQSYPEIIITGHADGSVKFWDASAITLQVLYKLKTSK
VFEKSRNKDDRPNTDIVDEDPYAIQIISWCPESRMLCIAGVSAHVIIYRFSKQEVITEVI
PMLEVRLLYEINDVETPEGEQPPPLPTPVGGSNPQPIPPQSHPSTSSSSSDGLRDNVPCL
KVKNSPLKQSPGYQTELVIQLVWVGGEPPQQITSLAVNSSYGLVVFGNCNGIAMVDYLQK
AVLLNLGTIELYGSNDPYRREPRSPRKSRQPSGAGLCDISEGTVVPEDRCKSPTSGSSSP
HNSDDEQKMNNFIEKVKTKSRKFSKMVANDIAKMSRKLSLPTDLKPDLDVKDNSFSRSRS
SSVTSIDKESREAISALHFCETFTRKTDSSPSPCLWVGTTLGTVLVIALNLPPGGEQRLL
QPVIVSPSGTILRLKGAILRMAFLDTTGCLIPPAYEPWREHNVPEEKDEKEKLKKRRPVS
VSPSSSQEISENQYAVICSEKQAKVISLPTQNCAYKQNITETSFVLRGDIVALSNSICLA
CFCANGHIMTFSLPSLRPLLDVYYLPLTNMRIARTFCFTNNGQALYLVSPTEIQRLTYSQ
ETCENLQEMLGELFTPVETPEAPNRGFFKGLFGGGAQSLDREELFGESSSGKASRSLAQH
IPGPGGIEGVKGAASGVVGELARARLALDERGQKLGDLEERTAAMLSSAESFSKHAHEIM
LKYKDKKWYQF
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaattcaacatcaggaaggtgctggacggcctgaccgccggctcgtcctcggcg
tcgcagcagcaacagcagcagcatccgcctgggaaccgggagccggagatccaggaaacg
ctccagtccgagcactttcagctctgcaagactgttcgccatggatttccctatcaaccc
tcagccctggcctttgatcctgtacagaagatcctggcagtgggaactcagactggtgct
ttaaggctctttggtcgtccaggagtagaatgttattgccagcatgacagtggagctgca
gtaatccagctccagttcctgattaatgagggagcgcttgtgagtgccttggctgatgac
accttacacttatggaatttacgtcagaagaggcctgccatactacattcgcttaaattt
tgcagagaaagggttacattttgccatctgcctttccagagtaagtggctctatgtgggc
actgaacgaggtaatatacatattgtcaatgtggagtccttcacactctcaggctacgtc
attatgtggaataaagccattgaactgtcatctaaatctcacccaggacctgtggtccat
ataagtgataatccaatggacgagggaaagcttttgattggctttgaatctggaacagta
gttttatgggacctcaaatcaaagaaagccgactacagatacacatatgatgaggctatc
cactctgttgcttggcatcatgaaggaaaacaatttatttgcagtcattcagatggcacc
ttgactatatggaatgtaaggtcccctgctaaaccagtacagacaatcactccacatgga
aaacagttaaaggatgggaagaagccagaaccatgcaaacctatcctcaaggtggaattc
aaaacgactagatctggggagccttttattattttatcaggaggtttgtcatatgatact
gtaggaagaagaccttgcttaacagtgatgcatgggaaaagcactgctgtgctagaaatg
gactattcaattgttgattttctaacgctgtgtgaaacaccatacccaaatgattttcaa
gaaccatatgctgtggttgttcttctagaaaaggatttagtacttatagaccttgcacaa
aatggatatcctatatttgaaaatccctaccctttgagtatacatgagtcccctgttaca
tgttgcgaatattttgcggattgtcctgtggaccttattcctgcactttattctgttgga
gctagacagaaacgtcaaggttacagcaaaaaggaatggcccatcaacggaggtaattgg
ggcttgggtgctcaaagttacccagaaataattattacagggcatgctgatgggtcagtt
aagttctgggatgcttctgcaataactctacaagtattatataagctaaagacatctaaa
gtatttgaaaagtcaagaaataaagatgacaggccaaacacagacattgtagatgaagat
ccatatgccattcagatcatctcctggtgtccagaaagtagaatgctgtgcatcgctgga
gtttcagctcatgtcattatttatagattcagcaagcaggaagtaatcacagaagtcatt
ccgatgcttgaagttcgattattatatgagataaatgatgtggaaactccggagggtgag
cagccaccacctttgccaacacccgtgggagggtccaaccctcagcccatccctcctcag
tctcatccatctaccagtagcagttcatctgatgggcttcgtgataatgtaccttgttta
aaagttaaaaactcaccacttaaacagtctccaggttatcaaacagaactagttattcag
ttggtttgggtgggtggagaaccaccacaacaaataaccagcctggcagtcaattcttcc
tatggactggtggtttttggcaattgcaatggcattgctatggttgactacctccagaaa
gcagtgctgctcaacctgggcactattgaattatatggctctaatgatccttatcggaga
gaaccccgatctcctcgtaaatctcgacagccttcaggagccggtctgtgtgatattagt
gaagggactgttgttccagaggatcgctgcaaatctccaacctctggttcttcatcacca
cacaattcagatgatgaacaaaaaatgaataattttatagaaaaggtgaagaccaaaagc
agaaagttttccaagatggtagccaatgatatagcaaagatgtcaaggaagttaagctta
cctactgacctaaagcctgatttagatgtaaaggataactcctttagccgatcacggagt
tcaagtgtaacaagcattgacaaagaatcccgagaagcgatctccgctcttcatttctgt
gaaacgtttactcgaaagacggactcgtccccttccccttgtctatgggttggaacaacg
ctaggaacagtgcttgtcattgcactgaaccttcccccagggggagagcaaagacttctt
cagccagtaattgtgtctccaagtggtactatattgaggttaaaaggtgcaatcttgaga
atggcatttctggataccacaggctgcttaataccacctgcgtatgaaccctggagagag
cacaatgttcctgaagaaaaagacgaaaaggagaaattgaaaaaacggcggcctgtctca
gtatccccctcctcttctcaggaaattagtgaaaaccagtatgcagtgatatgttctgaa
aagcaagcaaaagtaatctcactgccaacccagaactgtgcttataagcaaaatattaca
gagacctcgtttgtgcttcgtggagatattgtagcattgagtaacagtatctgccttgcc
tgtttctgtgccaatggacatataatgacttttagtttgccaagtttaagacctctgttg
gatgtgtattacttgccccttaccaatatgcggatagccagaacgttctgctttaccaac
aatggacaagcattataccttgtttcacctacagaaatccagagacttacttatagtcaa
gagacctgtgaaaatcttcaggaaatgttgggtgaactcttcactcctgtagaaacacct
gaagcaccaaacaggggattctttaaaggcttatttggaggtggtgcacaatctcttgac
agagaagaactatttggagaatcgtcctcaggaaaggcttcaaggagccttgcacagcat
attcctggccctggtggcattgaaggcgtaaaaggggcagcatctggagttgttggtgaa
ttagcacgagccaggctggcactagatgaaagagggcagaaacttggcgatctggaagaa
agaactgcggccatgttatcaagtgcagagtcattttctaaacatgctcatgagattatg
ttgaaatacaaagataagaagtggtaccagttctga

DBGET integrated database retrieval system