KEGG   Homo sapiens (human): 135Help
Entry
135               CDS       T01001                                 

Gene name
ADORA2A, A2aR, ADORA2, RDC8
Definition
(RefSeq) adenosine A2a receptor
  KO
K04266  adenosine receptor A2a
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
hsa05012  Parkinson's disease
hsa05034  Alcoholism
Drug target
Adenosine (DG00243): D00045 D02300 D02769 D08646 D08647
Apadenoson: D03212
Binodenoson: D03120
Caffeine (DG00974): D00528 D01453 D07603
Choline theophyllinate: D02017
Doxofylline: D03898
Enprofylline: D04006
Evodenoson: D10362
Istradefylline: D04641
Preladenant: D09717
Proxyphylline: D01771
Regadenoson: D05711
Sonedenoson: D09003
Tozadenant: D10174
Vipadenant: D09991
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    135 (ADORA2A)
   04020 Calcium signaling pathway
    135 (ADORA2A)
   04024 cAMP signaling pathway
    135 (ADORA2A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    135 (ADORA2A)
 Organismal Systems
  Circulatory system
   04270 Vascular smooth muscle contraction
    135 (ADORA2A)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    135 (ADORA2A)
  Substance dependence
   05034 Alcoholism
    135 (ADORA2A)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Base and nucleoside
   Adenosine
    135 (ADORA2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 GPR_Gpa2_C Ni_hydr_CYTB
Motif
Other DBs
NCBI-GeneID: 135
NCBI-ProteinID: NP_000666
OMIM: 102776
HGNC: 263
Ensembl: ENSG00000128271
Vega: OTTHUMG00000150761
Pharos: P29274(Tclin)
UniProt: P29274 B3KVQ4 X5DNB4
Structure
PDB: 

Position
22q11.23
AA seq 412 aa AA seqDB search
MPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAI
PFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTR
AKGIIAICWVLSFAIGLTPMLGWNNCGQPKEGKNHSQGCGEGQVACLFEDVVPMNYMVYF
NFFACVLVPLLLMLGVYLRIFLAARRQLKQMESQPLPGERARSTLQKEVHAAKSLAIIVG
LFALCWLPLHIINCFTFFCPDCSHAPLWLMYLAIVLSHTNSVVNPFIYAYRIREFRQTFR
KIIRSHVLRQQEPFKAAGTSARVLAAHGSDGEQVSLRLNGHPPGVWANGSAPHPERRPNG
YALGLVSGGSAQESQGNTGLPDVELLSHELKGVCPEPPGLDDPLAQDGAGVS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcatgggctcctcggtgtacatcacggtggagctggccattgctgtgctggcc
atcctgggcaatgtgctggtgtgctgggccgtgtggctcaacagcaacctgcagaacgtc
accaactactttgtggtgtcactggcggcggccgacatcgcagtgggtgtgctcgccatc
ccctttgccatcaccatcagcaccgggttctgcgctgcctgccacggctgcctcttcatt
gcctgcttcgtcctggtcctcacgcagagctccatcttcagtctcctggccatcgccatt
gaccgctacattgccatccgcatcccgctccggtacaatggcttggtgaccggcacgagg
gctaagggcatcattgccatctgctgggtgctgtcgtttgccatcggcctgactcccatg
ctaggttggaacaactgcggtcagccaaaggagggcaagaaccactcccagggctgcggg
gagggccaagtggcctgtctctttgaggatgtggtccccatgaactacatggtgtacttc
aacttctttgcctgtgtgctggtgcccctgctgctcatgctgggtgtctatttgcggatc
ttcctggcggcgcgacgacagctgaagcagatggagagccagcctctgccgggggagcgg
gcacggtccacactgcagaaggaggtccatgctgccaagtcactggccatcattgtgggg
ctctttgccctctgctggctgcccctacacatcatcaactgcttcactttcttctgcccc
gactgcagccacgcccctctctggctcatgtacctggccatcgtcctctcccacaccaat
tcggttgtgaatcccttcatctacgcctaccgtatccgcgagttccgccagaccttccgc
aagatcattcgcagccacgtcctgaggcagcaagaacctttcaaggcagctggcaccagt
gcccgggtcttggcagctcatggcagtgacggagagcaggtcagcctccgtctcaacggc
cacccgccaggagtgtgggccaacggcagtgctccccaccctgagcggaggcccaatggc
tatgccctggggctggtgagtggagggagtgcccaagagtcccaggggaacacgggcctc
ccagacgtggagctccttagccatgagctcaagggagtgtgcccagagccccctggccta
gatgaccccctggcccaggatggagcaggagtgtcctga

DBGET integrated database retrieval system