KEGG   Homo sapiens (human): 1350
Entry
1350              CDS       T01001                                 

Gene name
COX7C
Definition
(RefSeq) cytochrome c oxidase subunit 7C
  KO
K02272  cytochrome c oxidase subunit 7c
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00154  Cytochrome c oxidase
Network
nt06418  Oxidative phosphorylation
nt06460  Alzheimer disease
  Element
N00998  Electron transfer in Complex IV
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1350 (COX7C)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    1350 (COX7C)
  09159 Environmental adaptation
   04714 Thermogenesis
    1350 (COX7C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    1350 (COX7C)
   05012 Parkinson disease
    1350 (COX7C)
   05014 Amyotrophic lateral sclerosis
    1350 (COX7C)
   05016 Huntington disease
    1350 (COX7C)
   05020 Prion disease
    1350 (COX7C)
   05022 Pathways of neurodegeneration - multiple diseases
    1350 (COX7C)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    1350 (COX7C)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    1350 (COX7C)
SSDB
Motif
Pfam: COX7C
Other DBs
NCBI-GeneID: 1350
NCBI-ProteinID: NP_001858
OMIM: 603774
HGNC: 2292
Ensembl: ENSG00000127184
Vega: OTTHUMG00000119049
Pharos: P15954(Tdark)
UniProt: P15954
Structure
PDB: 
5Z62

Position
5q14.3
AA seq 63 aa
MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQL
LKT
NT seq 192 nt   +upstreamnt  +downstreamnt
atgttgggccagagcatccggaggttcacaacctctgtggtccgtaggagccactatgag
gagggccctgggaagaatttgccattttcagtggaaaacaagtggtcgttactagctaag
atgtgtttgtactttggatctgcatttgctacacccttccttgtagtaagacaccaactg
cttaaaacataa

DBGET integrated database retrieval system