KEGG   Homo sapiens (human): 135112
Entry
135112            CDS       T01001                                 
Symbol
NCOA7, ERAP140, ESNA1, NCOA7-AS, Nbla00052, Nbla10993, TLDC4, dJ187J11.3
Name
(RefSeq) nuclear receptor coactivator 7
  KO
K25442  nuclear receptor coactivator 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    135112 (NCOA7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    135112 (NCOA7)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Others
   Others
    135112 (NCOA7)
SSDB
Motif
Pfam: TLD LysM GRAM
Other DBs
NCBI-GeneID: 135112
NCBI-ProteinID: NP_001186548
OMIM: 609752
HGNC: 21081
Ensembl: ENSG00000111912
UniProt: Q8NI08 Q8N3C8
Structure
Position
6:125781115..125932034
AA seq 942 aa
MDTKEEKKERKQSYFARLKKKKQAKQNAETASAVATRTHTGKEDNNTVVLEPDKCNIAVE
EEYMTDEKKKRKSNQLKEIRRTELKRYYSIDDNQNKTHDKKEKKMVVQKPHGTMEYTAGN
QDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANSPSSTLRLSSSSPGATVSP
SSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVM
IVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPQD
LCPLYRPGEWEDLASEKDINPFSKFKSINKEKRQQNGEKIMTSDSRPIVPLEKSTGHTPT
KPSGSSVSEKLKKLDSSRETSHGSPTVTKLSKEPSDTSSAFESTAKENFLGEDDDFVDLE
ELSSQTGGGMHKKDTLKECLSLDPEERKKAESQINNSAVEMQVQSALAFLGTENDVELKG
ALDLETCEKQDIMPEVDKQSGSPESRVENTLNIHEDLDKVKLIEYYLTKNKEGPQVSENL
QKTELSDGKSIEPGGIDITLSSSLSQAGDPITEGNKEPDKTWVKKGEPLPVKLNSSTEAN
VIKEALDSSLESTLDNSCQGAQMDNKSEVQLWLLKRIQVPIEDILPSKEEKSKTPPMFLC
IKVGKPMRKSFATHTAAMVQQYGKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDAK
EQGFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSTCSYYEDEDEEVLPVLRPHS
ALLENMHIEQLARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMDN
QIFGAYATHPFKFSDHYYGTGETFLYTFSPHFKVFKWSGENSYFINGDISSLELGGGGGR
FGLWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLEVWAFD
NT seq 2829 nt   +upstreamnt  +downstreamnt
atggataccaaggaagagaagaaggaacggaaacaaagttattttgctcgactgaaaaag
aaaaaacaagccaaacaaaatgcagagacagcctcagctgtagctacaaggactcatact
gggaaggaagataataatacagtagttttagagccagacaagtgcaacattgctgtggaa
gaggaatatatgactgatgagaaaaaaaagagaaaaagtaatcagttaaaggagatcagg
cgtacagaactaaagagatattatagtattgatgacaatcaaaacaaaacacatgataaa
aaagagaagaagatggtggttcagaagccccatgggactatggaatacactgctggaaac
caggacaccctaaactccatagcactgaaatttaacatcactcccaataaattggtggaa
ctgaataaacttttcacacatactattgttccaggccaggtcctttttgtgccagatgcc
aactctccttccagtaccttaaggctatcatcatccagtcctggtgctactgtctctcct
tcatcatcagatgcagaatatgataaattgcctgatgctgacttagcacgaaaggccttg
aaacccattgaaagagtcttatcgtctacttctgaagaagatgagccaggtgtggtgaaa
tttttaaaaatgaattgtcgatacttcaccgatggaaagggtgtggttggcggtgttatg
atagtgactcctaacaacatcatgtttgaccctcataaatctgatcctctggttattgaa
aatgggtgtgaggagtatggtctcatctgccccatggaagaggttgtttccattgcgctc
tacaatgacatttctcacatgaagatcaaagatgccttgccatctgacctacctcaggat
ctttgtcctctgtacaggcctggagaatgggaagacctggcttcagaaaaggatatcaac
ccattcagtaagttcaaatctatcaacaaggaaaaacgacagcagaatggagagaaaatt
atgacttcggattccagaccaatagtacctttggagaagtccacaggacatacacctaca
aagccctcaggcagctctgtgtcagagaaattaaagaaactggactcctctagggagaca
tcccatggttctcccacagtgactaagctcagcaaggaaccttccgacacttcttctgca
tttgaatctacagccaaagaaaactttctaggggaagatgatgattttgttgacttggaa
gaactttcttctcaaactggtggtggaatgcacaaaaaagacaccttgaaggagtgcctt
tctcttgacccagaggaacgaaagaaagctgagtcacaaataaacaattctgccgtggaa
atgcaggtgcagtcagccctagcctttttgggaacagagaatgatgttgaactgaagggg
gcgctagatttagaaacctgtgagaagcaagatataatgccagaagtggacaagcagtct
ggttcgccagaaagccgagtagaaaacacactgaacatacatgaagatttagataaagtt
aaactcattgaatattacctgactaagaacaaagaagggccacaggtatctgaaaatttg
cagaaaacagaattaagtgatggaaaaagtattgaaccagggggaatagacattaccctt
agtagttctctttcccaggcgggtgatcccataactgagggcaataaagagccagataag
acctgggtgaaaaagggagagcccctcccggtaaaactgaactcttctacagaagcaaat
gtgattaaagaggctctagactcctctttggaatctactctggacaacagctgtcaaggt
gcacaaatggataataaatctgaagttcagttgtggctgttaaagagaattcaggtaccc
attgaagatatacttccttcaaaagaagaaaaaagcaagaccccacccatgttcctgtgc
atcaaagtgggaaaaccaatgagaaaatcctttgccactcacactgcagccatggtccag
cagtacggcaaacggagaaagcagccagagtactggtttgctgttcctcgggagagggtg
gatcatttgtacacattctttgttcagtggtctcccgatgtctatggaaaagatgccaaa
gagcaaggctttgtggtggtggagaaggaagaactgaacatgattgacaacttcttcagt
gagccaacaaccaagagctgggagatcatcactgttgaagaggcaaagcgcaggaagagc
acatgcagctactatgaagacgaggacgaagaggtgctgcctgtcctacggccccacagc
gcgctcctggagaatatgcacatcgagcagctggcccgacgccttcctgcaagggtgcaa
gggtatccatggagactggcctatagcacgttagagcacgggaccagcttaaagacgctc
taccggaaatcggcatcactagacagtcctgtcctattggtcatcaaagatatggataat
cagatttttggagcatatgcaactcatcctttcaagttcagtgaccactattatggcaca
ggcgaaacttttctctacacattcagccctcattttaaggtctttaagtggagtggagaa
aattcatactttatcaatggagacataagttctttagaacttggtggtggagggggacga
tttggtttatggctagatgctgatttataccacggacgaagcaactcttgcagcactttc
aataatgatattctttccaaaaaggaagacttcatagttcaggatctggaggtgtgggca
tttgattga

DBGET integrated database retrieval system