KEGG   Homo sapiens (human): 135152Help
Entry
135152            CDS       T01001                                 

Gene name
B3GAT2, GLCATS
Definition
(RefSeq) beta-1,3-glucuronyltransferase 2
  KO
K10157  galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 2 [EC:2.4.1.135]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00515  Mannose type O-glycan biosynthesis
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    135152 (B3GAT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    135152 (B3GAT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.135  galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase
     135152 (B3GAT2)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   135152 (B3GAT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_43
Motif
Other DBs
NCBI-GeneID: 135152
NCBI-ProteinID: NP_542780
OMIM: 607497
HGNC: 922
Ensembl: ENSG00000112309
Vega: OTTHUMG00000014997
Pharos: Q9NPZ5(Tbio)
UniProt: Q9NPZ5
Structure
PDB: 

Position
6q13
AA seq 323 aa AA seqDB search
MKSALFTRFFILLPWILIVIIMLDVDTRRPVPPLTPRPYFSPYAVGRGGARLPLRRGGPA
HGTQKRNQSRPQPQPEPQLPTIYAITPTYSRPVQKAELTRLANTFRQVAQLHWILVEDAA
ARSELVSRFLARAGLPSTHLHVPTPRRYKRPGLPRATEQRNAGLAWLRQRHQHQRAQPGV
LFFADDDNTYSLELFQEMRTTRKVSVWPVGLVGGRRYERPLVENGKVVGWYTGWRADRPF
AIDMAGFAVSLQVILSNPKAVFKRRGSQPGMQESDFLKQITTVEELEPKANNCTKVLVWH
TRTEKVNLANEPKYHLDTVKIEV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccgcgcttttcacccgcttctttatcctcctgccctggatcctaattgtcatc
atcatgctcgacgtggacacgcgcaggccagtgcccccgctcaccccgcgcccctacttc
tctccctacgcggtgggccgcgggggcgcccgactcccgctccgcaggggcggcccggct
cacgggacccaaaagcgcaaccagtctcggccgcagccacagccggagccgcagctgccc
accatctatgccatcacgcccacctacagccgcccggtgcagaaagcggagctgacccgc
ctggccaacacgttccgccaggtggcgcagctgcactggatcctggtggaggacgcggcg
gcgcgcagcgagctggtgagccgcttcctggcgcgggccgggctgcccagcactcacctg
cacgtgcccacgccgcggcgctacaagcggcccgggctgccgcgcgccactgagcagcgc
aacgcgggcctcgcctggctgcgccagaggcaccagcaccagcgcgcgcagcccggcgtg
ctcttcttcgctgacgacgacaacacctatagtctggagctcttccaggagatgcgaacc
acccgcaaggtctccgtctggcctgtgggcctggttggtgggcggcgctacgaacgtccg
ctggtggaaaacggcaaagttgttggctggtacaccggctggagagcagacaggcctttt
gccatcgacatggcaggatttgctgtaagtcttcaagtcattttgtccaatccaaaagct
gtatttaagcgtcgtggatcccagccagggatgcaagaatctgactttctcaaacagata
acaacagtcgaagaactggaaccgaaagcaaataactgcactaaggttctcgtgtggcac
actcggacagagaaggttaatctagccaacgagccaaagtaccacctggacacagtgaaa
attgaggtataa

DBGET integrated database retrieval system