KEGG   Homo sapiens (human): 1352Help
Entry
1352              CDS       T01001                                 

Gene name
COX10
Definition
(RefSeq) COX10, heme A:farnesyltransferase cytochrome c oxidase assembly factor
  KO
K02257  heme o synthase [EC:2.5.1.141]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa00860  Porphyrin and chlorophyll metabolism
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
Module
hsa_M00154  Cytochrome c oxidase
Disease
H01354  Leigh syndrome
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    1352 (COX10)
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    1352 (COX10)
 Organismal Systems
  Environmental adaptation
   04714 Thermogenesis
    1352 (COX10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.141  heme o synthase
     1352 (COX10)
Prenyltransferases [BR:hsa01006]
 Compound prenylation
  Protoheme farnesyltransferase
   1352 (COX10)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    1352 (COX10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UbiA
Motif
Other DBs
NCBI-GeneID: 1352
NCBI-ProteinID: NP_001294
OMIM: 602125
HGNC: 2260
Ensembl: ENSG00000006695
Vega: OTTHUMG00000058814
Pharos: Q12887(Tbio)
UniProt: Q12887
Position
17p12
AA seq 443 aa AA seqDB search
MAASPHTLSSRLLTGCVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMY
VTQLNRSHNQQVRPKPEPVASPFLEKTSSGQAKAEIYEMRPLSPPSLSLSRKPNEKELIE
LEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLSKIKLTALVVSTTAAGFALA
PGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGQISPLLAVSFA
TCCAVPGVAILTLGVNPLTGALGLFNIFLYTCCYTPLKRISIANTWVGAVVGAIPPVMGW
TAATGSLDAGAFLLGGILYSWQFPHFNALSWGLREDYSRGGYCMMSVTHPGLCRRVALRH
CLALLVLSAAAPVLDITTWTFPIMALPINAYISYLGFRFYVDADRRSSRRLFFCSLWHLP
LLLLLMLTCKRPSGGGDAGPPPS
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggccgcatctccgcacactctctcctcacgcctcctgacaggttgcgtaggaggctct
gtctggtatcttgaaagaagaactatacaggactcccctcacaagttcttacatcttctc
aggaatgtcaataagcagtggattacatttcagcactttagcttcctcaaacgcatgtat
gtcacacagctgaacagaagccacaaccagcaagtaagacccaagccagaaccagtagca
tctcctttccttgaaaaaacatcttcaggtcaagccaaagcagaaatatatgagatgaga
cctctctcaccgcccagcctatctttgtccagaaagccaaatgaaaaggaattgatagaa
ctagagccagactcagtaattgaagactcaatagatgtagggaaagagacaaaagaggaa
aagcggtggaaagagatgaagctgcaagtgtatgatttgccaggaattttggctcgacta
tccaaaatcaaactcacagctctggttgtaagtaccactgcagctggatttgcattggct
ccgggcccttttgactggccctgtttcctgcttacttctgttgggacaggccttgcatcc
tgtgctgccaactccatcaatcagttttttgaggtgccatttgactcaaacatgaatagg
acaaagaacagaccgctggttcgtggacagatcagcccattgctagctgtgtcctttgcc
acttgttgtgctgttccgggagttgccattctgaccttgggggtgaatccactcacagga
gccctggggctcttcaacattttcctgtatacctgctgctacacaccactgaaaaggatc
agcattgccaacacatgggtcggagctgtggttggggccatcccgcctgtcatgggctgg
acagcggccacgggcagcctcgatgctggcgcatttctcctgggaggaatcctctactcc
tggcagtttcctcatttcaacgccctgagctggggcctccgtgaagactactcccggggc
ggctactgcatgatgtcggtcacccacccgggcctgtgccggcgcgtggcgctgcgccac
tgcctggccctgctcgtgctgtccgcagcagcccctgtgctggacatcaccacatggacc
ttccccatcatggcccttcccatcaatgcgtacatctcctacctcggcttccgcttctac
gtggacgcagaccgcaggagctcgcggagactgttcttctgcagcctgtggcacctgccg
ctgctgctgctgctcatgctcacctgcaagcggccgagcggaggcggggacgcagggccc
cctcccagctga

DBGET integrated database retrieval system