KEGG   Homo sapiens (human): 1352Help
Entry
1352              CDS       T01001                                 

Gene name
COX10
Definition
(RefSeq) cytochrome c oxidase assembly factor heme A:farnesyltransferase COX10
  KO
K02257  heme o synthase [EC:2.5.1.141]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa00860  Porphyrin and chlorophyll metabolism
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
Module
hsa_M00154  Cytochrome c oxidase
Disease
H01354  Leigh syndrome
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1352 (COX10)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    1352 (COX10)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    1352 (COX10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:hsa01006]
    1352 (COX10)
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    1352 (COX10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.141  heme o synthase
     1352 (COX10)
Prenyltransferases [BR:hsa01006]
 Compound prenylation
  Protoheme farnesyltransferase
   1352 (COX10)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    1352 (COX10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UbiA
Motif
Other DBs
NCBI-GeneID: 1352
NCBI-ProteinID: NP_001294
OMIM: 602125
HGNC: 2260
Ensembl: ENSG00000006695
Vega: OTTHUMG00000058814
Pharos: Q12887(Tbio)
UniProt: Q12887
Position
17p12
AA seq 443 aa AA seqDB search
MAASPHTLSSRLLTGCVGGSVWYLERRTIQDSPHKFLHLLRNVNKQWITFQHFSFLKRMY
VTQLNRSHNQQVRPKPEPVASPFLEKTSSGQAKAEIYEMRPLSPPSLSLSRKPNEKELIE
LEPDSVIEDSIDVGKETKEEKRWKEMKLQVYDLPGILARLSKIKLTALVVSTTAAGFALA
PGPFDWPCFLLTSVGTGLASCAANSINQFFEVPFDSNMNRTKNRPLVRGQISPLLAVSFA
TCCAVPGVAILTLGVNPLTGALGLFNIFLYTCCYTPLKRISIANTWVGAVVGAIPPVMGW
TAATGSLDAGAFLLGGILYSWQFPHFNALSWGLREDYSRGGYCMMSVTHPGLCRRVALRH
CLALLVLSAAAPVLDITTWTFPIMALPINAYISYLGFRFYVDADRRSSRRLFFCSLWHLP
LLLLLMLTCKRPSGGGDAGPPPS
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggccgcatctccgcacactctctcctcacgcctcctgacaggttgcgtaggaggctct
gtctggtatcttgaaagaagaactatacaggactcccctcacaagttcttacatcttctc
aggaatgtcaataagcagtggattacatttcagcactttagcttcctcaaacgcatgtat
gtcacacagctgaacagaagccacaaccagcaagtaagacccaagccagaaccagtagca
tctcctttccttgaaaaaacatcttcaggtcaagccaaagcagaaatatatgagatgaga
cctctctcaccgcccagcctatctttgtccagaaagccaaatgaaaaggaattgatagaa
ctagagccagactcagtaattgaagactcaatagatgtagggaaagagacaaaagaggaa
aagcggtggaaagagatgaagctgcaagtgtatgatttgccaggaattttggctcgacta
tccaaaatcaaactcacagctctggttgtaagtaccactgcagctggatttgcattggct
ccgggcccttttgactggccctgtttcctgcttacttctgttgggacaggccttgcatcc
tgtgctgccaactccatcaatcagttttttgaggtgccatttgactcaaacatgaatagg
acaaagaacagaccgctggttcgtggacagatcagcccattgctagctgtgtcctttgcc
acttgttgtgctgttccgggagttgccattctgaccttgggggtgaatccactcacagga
gccctggggctcttcaacattttcctgtatacctgctgctacacaccactgaaaaggatc
agcattgccaacacatgggtcggagctgtggttggggccatcccgcctgtcatgggctgg
acagcggccacgggcagcctcgatgctggcgcatttctcctgggaggaatcctctactcc
tggcagtttcctcatttcaacgccctgagctggggcctccgtgaagactactcccggggc
ggctactgcatgatgtcggtcacccacccgggcctgtgccggcgcgtggcgctgcgccac
tgcctggccctgctcgtgctgtccgcagcagcccctgtgctggacatcaccacatggacc
ttccccatcatggcccttcccatcaatgcgtacatctcctacctcggcttccgcttctac
gtggacgcagaccgcaggagctcgcggagactgttcttctgcagcctgtggcacctgccg
ctgctgctgctgctcatgctcacctgcaagcggccgagcggaggcggggacgcagggccc
cctcccagctga

DBGET integrated database retrieval system