KEGG   Homo sapiens (human): 135250Help
Entry
135250            CDS       T01001                                 

Gene name
RAET1E, LETAL, N2DL-4, NKG2DL4, RAET1E2, RL-4, ULBP4, bA350J20.7
Definition
(RefSeq) retinoic acid early transcript 1E
  KO
K07987  retinoic acid early transcript 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    135250 (RAET1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I MHC_I_2
Motif
Other DBs
NCBI-GeneID: 135250
NCBI-ProteinID: NP_631904
OMIM: 609243
HGNC: 16793
Ensembl: ENSG00000164520
Vega: OTTHUMG00000015796
Pharos: Q8TD07(Tbio)
UniProt: Q8TD07
Position
6q25.1
AA seq 263 aa AA seqDB search
MRRISLTSSPVRLLLFLLLLLIALEIMVGGHSLCFNFTIKSLSRPGQPWCEAQVFLNKNL
FLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTL
QVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKY
FRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDRWIILGAFILLVLMG
IVLICVWWQNGEWQAGLWPLRTS
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgcgaagaatatccctgacttctagccctgtgcgccttcttttgtttctgctgttgcta
ctaatagccttggagatcatggttggtggtcactctctttgcttcaacttcactataaaa
tcattgtccagacctggacagccctggtgtgaagcgcaggtcttcttgaataaaaatctt
ttccttcagtacaacagtgacaacaacatggtcaaacctctgggcctcctggggaagaag
gtatatgccaccagcacttggggagaattgacccaaacgctgggagaagtggggcgagac
ctcaggatgctcctttgtgacatcaaaccccagataaagaccagtgatccttccactctg
caagtcgagatgttttgtcaacgtgaagcagaacggtgcactggtgcatcctggcagttc
gccaccaatggagagaaatccctcctctttgacgcaatgaacatgacctggacagtaatt
aatcatgaagccagtaagatcaaggagacatggaagaaagacagagggctggaaaagtat
ttcaggaagctctcaaagggagactgcgatcactggctcagggaattcttagggcactgg
gaggcaatgccagaaccgacagtgtcaccagtaaatgcttcagatatccactggtcttct
tctagtctaccagatagatggatcatcctgggggcattcatcctgttagttttaatggga
attgttctcatctgtgtctggtggcaaaatggtgagtggcaggctggtctctggcccttg
aggacgtcttag

DBGET integrated database retrieval system