KEGG   Homo sapiens (human): 1355Help
Entry
1355              CDS       T01001                                 

Gene name
COX15, CEMCOX2
Definition
(RefSeq) cytochrome c oxidase assembly homolog COX15
  KO
K02259  cytochrome c oxidase assembly protein subunit 15
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa00860  Porphyrin and chlorophyll metabolism
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
Module
hsa_M00154  Cytochrome c oxidase
Disease
H01200  Fatal infantile cardioencephalomyopathy
H01354  Leigh syndrome
H01368  Cytochrome c oxidase (COX) deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    1355 (COX15)
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    1355 (COX15)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    1355 (COX15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    1355 (COX15)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    1355 (COX15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX15-CtaA Peptidase_S3
Motif
Other DBs
NCBI-GeneID: 1355
NCBI-ProteinID: NP_510870
OMIM: 603646
HGNC: 2263
Ensembl: ENSG00000014919
Vega: OTTHUMG00000018893
Pharos: Q7KZN9(Tbio)
UniProt: Q7KZN9
Position
10q24.2
AA seq 410 aa AA seqDB search
MQRLLFPPLRALKGRQYLPLLAPRAAPRAQCDCIRRPLRPGQYSTISEVALQSGRGTVSL
PSKAAERVVGRWLLVCSGTVAGAVILGGVTRLTESGLSMVDWHLIKEMKPPTSQEEWEAE
FQRYQQFPEFKILNHDMTLTEFKFIWYMEYSHRMWGRLVGLVYILPAAYFWRKGWLSRGM
KGRVLALCGLVCFQGLLGWYMVKSGLEEKSDSHDIPRVSQYRLAAHLGSALVLYCASLWT
SLSLLLPPHKLPETHQLLQLRRFAHGTAGLVFLTALSGAFVAGLDAGLVYNSFPKMGESW
IPEDLFTFSPILRNVFENPTMVQFDHRILGITSVTAITVLYFLSRRIPLPRRTKMAAVTL
LALAYTQVGLGISTLLMYVPTPLAATHQSGSLALLTGALWLMNELRRVPK
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgattgctctttccgccgttgagggccttgaaggggaggcagtatctgccgctc
ctggctcctagggcagcgcctagagcacagtgtgattgcatcaggcgccctttgaggcca
gggcaatacagcaccatctctgaagtagctttgcaatctggaaggggtacagtgtccctt
ccctcaaaggctgctgagcgggtggtgggccgatggctcctggtctgcagtggaacagtg
gctggagcagttattcttggtggagtaactaggttgacagagtctggcctctcgatggta
gattggcatttaataaaggagatgaagccacctacaagccaagaggaatgggaagcagaa
ttccaaagataccagcaatttccagaatttaaaatcttgaatcatgatatgacactgaca
gaattcaagttcatctggtacatggagtactcacaccgaatgtggggtcgccttgtaggc
cttgtgtacatcctgcctgctgcctacttttggagaaagggctggctcagccgtggcatg
aaaggacgtgttcttgccctctgtggcctcgtctgcttccagggtctgttgggatggtat
atggtgaaaagtggactagaagaaaaatcagactcccatgacatccctcgggtcagtcag
taccgccttgctgcccacctgggatcagccctggttctttattgtgccagcttgtggacc
tcactgtcactgctactccctccgcacaagttgcctgaaacccaccaactcctacagttg
agacgatttgctcatggaacagcaggtctggtgttccttacggccctctcaggggctttt
gtggcagggctagatgctgggcttgtttataactcctttcccaaaatgggagaatcctgg
atcccggaggacctctttaccttctcccccatcctgaggaatgtttttgagaatcccacc
atggtgcagtttgatcaccggattctgggaatcacttcagtcactgccattacagtgctc
tacttcctctctcggagaattccccttcctagaaggaccaagatggcagcagtgactctg
ctggctttggcgtatacacaggtgggcttgggcatcagcacgctgctgatgtatgtccca
actcctctggccgccactcaccagtcaggctccttggctttgctcactggtgctctttgg
ctgatgaatgaactccgaagagtcccaaaatga

DBGET integrated database retrieval system