KEGG   Homo sapiens (human): 1356Help
Entry
1356              CDS       T01001                                 

Gene name
CP, CP-2
Definition
(RefSeq) ceruloplasmin
  KO
K13624  ceruloplasmin [EC:1.16.3.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00860  Porphyrin and chlorophyll metabolism
hsa04216  Ferroptosis
Disease
H02206  Aceruloplasminemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    1356 (CP)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    1356 (CP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1356 (CP)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.16  Oxidizing metal ions
   1.16.3  With oxygen as acceptor
    1.16.3.1  ferroxidase
     1356 (CP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of cortical neuronal cells
   1356 (CP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu-oxidase_2 Cu-oxidase_3 Cu-oxidase
Motif
Other DBs
NCBI-GeneID: 1356
NCBI-ProteinID: NP_000087
OMIM: 117700
HGNC: 2295
Ensembl: ENSG00000047457
Vega: OTTHUMG00000159563
Pharos: P00450(Tbio)
UniProt: P00450 A5PL27
Structure
PDB: 

Position
3q24-q25.1
AA seq 1065 aa AA seqDB search
MKILILGIFLFLCSTPAWAKEKHYYIGIIETTWDYASDHGEKKLISVDTEHSNIYLQNGP
DRIGRLYKKALYLQYTDETFRTTIEKPVWLGFLGPIIKAETGDKVYVHLKNLASRPYTFH
SHGITYYKEHEGAIYPDNTTDFQRADDKVYPGEQYTYMLLATEEQSPGEGDGNCVTRIYH
SHIDAPKDIASGLIGPLIICKKDSLDKEKEKHIDREFVVMFSVVDENFSWYLEDNIKTYC
SEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFH
GQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQAFFQVQECNKS
SSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSY
KKLVYREYTDASFTNRKERGPEEEHLGILGPVIWAEVGDTIRVTFHNKGAYPLSIEPIGV
RFNKNNEGTYYSPNYNPQSRSVPPSASHVAPTETFTYEWTVPKEVGPTNADPVCLAKMYY
SAVDPTKDIFTGLIGPMKICKKGSLHANGRQKDVDKEFYLFPTVFDENESLLLEDNIRMF
TTAPDQVDKEDEDFQESNKMHSMNGFMYGNQPGLTMCKGDSVVWYLFSAGNEADVHGIYF
SGNTYLWRGERRDTANLFPQTSLTLHMWPDTEGTFNVECLTTDHYTGGMKQKYTVNQCRR
QSEDSTFYLGERTYYIAAVEVEWDYSPQREWEKELHHLQEQNVSNAFLDKGEFYIGSKYK
KVVYRQYTDSTFRVPVERKAEEEHLGILGPQLHADVGDKVKIIFKNMATRPYSIHAHGVQ
TESSTVTPTLPGETLTYVWKIPERSGAGTEDSACIPWAYYSTVDQVKDLYSGLIGPLIVC
RRPYLKVFNPRRKLEFALLFLVFDENESWYLDDNIKTYSDHPEKVNKDDEEFIESNKMHA
INGRMFGNLQGLTMHVGDEVNWYLMGMGNEIDLHTVHFHGHSFQYKHRGVYSSDVFDIFP
GTYQTLEMFPRTPGIWLLHCHVTDHIHAGMETTYTVLQNEDTKSG
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttgatacttggtatttttctgtttttatgtagtaccccagcctgggcgaaa
gaaaagcattattacattggaattattgaaacgacttgggattatgcctctgaccatggg
gaaaagaaacttatttctgttgacacggaacattccaatatctatcttcaaaatggccca
gatagaattgggagactatataagaaggccctttatcttcagtacacagatgaaaccttt
aggacaactatagaaaaaccggtctggcttgggtttttaggccctattatcaaagctgaa
actggagataaagtttatgtacacttaaaaaaccttgcctctaggccctacacctttcat
tcacatggaataacttactataaggaacatgagggggccatctaccctgataacaccaca
gattttcaaagagcagatgacaaagtatatccaggagagcagtatacatacatgttgctt
gccactgaagaacaaagtcctggggaaggagatggcaattgtgtgactaggatttaccat
tcccacattgatgctccaaaagatattgcctcaggactcatcggacctttaataatctgt
aaaaaagattctctagataaagaaaaagaaaaacatattgaccgagaatttgtggtgatg
ttttctgtggtggatgaaaatttcagctggtacctagaagacaacattaaaacctactgc
tcagaaccagagaaagttgacaaagacaacgaagacttccaggagagtaacagaatgtat
tctgtgaatggatacacttttggaagtctcccaggactctccatgtgtgctgaagacaga
gtaaaatggtacctttttggtatgggtaatgaagttgatgtgcacgcagctttctttcac
gggcaagcactgactaacaagaactaccgtattgacacaatcaacctctttcctgctacc
ctgtttgatgcttatatggtggcccagaaccctggagaatggatgctcagctgtcagaat
ctaaaccatctgaaagccggtttgcaagcctttttccaggtccaggagtgtaacaagtct
tcatcaaaggataatatccgtgggaagcatgttagacactactacattgccgctgaggaa
atcatctggaactatgctccctctggtatagacatcttcactaaagaaaacttaacagca
cctggaagtgactcagcggtgttttttgaacaaggtaccacaagaattggaggctcttat
aaaaagctggtttatcgtgagtacacagatgcctccttcacaaatcgaaaggagagaggc
cctgaagaagagcatcttggcatcctgggtcctgtcatttgggcagaggtgggagacacc
atcagagtaaccttccataacaaaggagcatatcccctcagtattgagccgattggggtg
agattcaataagaacaacgagggcacatactattccccaaattacaacccccagagcaga
agtgtgcctccttcagcctcccatgtggcacccacagaaacattcacctatgaatggact
gtccccaaagaagtaggacccactaatgcagatcctgtgtgtctagctaagatgtattat
tctgctgtggatcccactaaagatatattcactgggcttattgggccaatgaaaatatgc
aagaaaggaagtttacatgcaaatgggagacagaaagatgtagacaaggaattctatttg
tttcctacagtatttgatgagaatgagagtttactcctggaagataatattagaatgttt
acaactgcacctgatcaggtggataaggaagatgaagactttcaggaatctaataaaatg
cactccatgaatggattcatgtatgggaatcagccgggtctcactatgtgcaaaggagat
tcggtcgtgtggtacttattcagcgccggaaatgaggccgatgtacatggaatatacttt
tcaggaaacacatatctgtggagaggagaacggagagacacagcaaacctcttccctcaa
acaagtcttacgctccacatgtggcctgacacagaggggacttttaatgttgaatgcctt
acaactgatcattacacaggcggcatgaagcaaaaatatactgtgaaccaatgcaggcgg
cagtctgaggattccaccttctacctgggagagaggacatactatatcgcagcagtggag
gtggaatgggattattccccacaaagggagtgggaaaaggagctgcatcatttacaagag
cagaatgtttcaaatgcatttttagataagggagagttttacataggctcaaagtacaag
aaagttgtgtatcggcagtatactgatagcacattccgtgttccagtggagagaaaagct
gaagaagaacatctgggaattctaggtccacaacttcatgcagatgttggagacaaagtc
aaaattatctttaaaaacatggccacaaggccctactcaatacatgcccatggggtacaa
acagagagttctacagttactccaacattaccaggtgaaactctcacttacgtatggaaa
atcccagaaagatctggagctggaacagaggattctgcttgtattccatgggcttattat
tcaactgtggatcaagttaaggacctctacagtggattaattggccccctgattgtttgt
cgaagaccttacttgaaagtattcaatcccagaaggaaactggaatttgcccttctgttt
ctagtttttgatgagaatgaatcttggtacttagatgacaacatcaaaacatactctgat
caccccgagaaagtaaacaaagatgatgaggaattcatagaaagcaataaaatgcatgct
attaatggaagaatgtttggaaacctacaaggcctcacaatgcacgtgggagatgaagtc
aactggtatctgatgggaatgggcaatgaaatagacttacacactgtacattttcacggc
catagcttccaatacaagcacaggggagtttatagttctgatgtctttgacattttccct
ggaacataccaaaccctagaaatgtttccaagaacacctggaatttggttactccactgc
catgtgaccgaccacattcatgctggaatggaaaccacttacaccgttctacaaaatgaa
gacaccaaatctggctga

DBGET integrated database retrieval system