KEGG   Homo sapiens (human): 1357
Entry
1357              CDS       T01001                                 

Gene name
CPA1, CPA
Definition
(RefSeq) carboxypeptidase A1
  KO
K08779  carboxypeptidase A1 [EC:3.4.17.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    1357 (CPA1)
   04974 Protein digestion and absorption
    1357 (CPA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1357 (CPA1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    1357 (CPA1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     1357 (CPA1)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   1357 (CPA1)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Other peptidases
   1357 (CPA1)
SSDB
Motif
Pfam: Peptidase_M14 Propep_M14 Phage_min_tail
Other DBs
NCBI-GeneID: 1357
NCBI-ProteinID: NP_001859
OMIM: 114850
HGNC: 2296
Ensembl: ENSG00000091704
Vega: OTTHUMG00000157826
Pharos: P15085(Tchem)
UniProt: P15085
Structure
PDB: 

Position
7q32.2
AA seq 419 aa
MRGLLVLSVLLGAVFGKEDFVGHQVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPG
SPIDVRVPFPSIQAVKIFLESHGISYETMIEDVQSLLDEEQEQMFAFRSRARSTDTFNYA
TYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHS
REWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTR
SHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIK
AFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQA
SGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHPY
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgcgggggttgctggtgttgagtgtcctgttgggggctgtctttggcaaggaggacttt
gtggggcatcaggtgctccgaatctctgtagccgatgaggcccaggtacagaaggtgaag
gagctggaggacctggagcacctgcagctggacttctggcgggggcctgcccaccctggc
tcccccatcgacgtccgagtgcccttccccagcatccaggcggtcaagatctttctggag
tcccacggcatcagctatgagaccatgatcgaggacgtgcagtcgctgctggacgaggag
caggagcagatgttcgccttccggtcccgggcgcgctccaccgacacttttaactacgcc
acctaccacaccctggaggagatctatgacttcctggacctgctggtggcggagaacccg
caccttgtcagcaagatccagattggcaacacctatgaagggcgtcccatttacgtgctg
aagttcagcacggggggcagtaagcgtccagccatctggatcgacacgggcatccattcc
cgggagtgggtcacccaggccagtggggtctggtttgcaaagaagatcactcaagactac
gggcaggatgcagctttcaccgccattctcgacaccttggacatcttcctggagatcgtc
accaaccctgatggctttgccttcacgcacagcacgaatcgcatgtggcgcaagactcgg
tcccacacagcaggctccctctgtattggcgtggaccccaacaggaactgggacgctggc
tttgggttgtccggagccagcagtaacccctgctcggagacttaccacggcaagtttgcc
aattccgaagtggaggtcaagtccattgtagactttgtgaaggaccatgggaacatcaag
gccttcatctccatccacagctactcccagctcctcatgtatccctatggctacaaaaca
gaaccagtccctgaccaggatgagctggatcagctttccaaggctgctgtgacagccctg
gcctctctctacgggaccaagttcaactatggcagcatcatcaaggcaatttatcaagcc
agtggaagcactattgactggacctacagccagggcatcaagtactccttcaccttcgag
ctccgggacactgggcgctatggcttcctgctgccagcctcccagatcatccccacagcc
aaggagacgtggctggcgcttctgaccatcatggagcacaccctgaatcacccctactga

KEGG   Homo sapiens (human): 1358
Entry
1358              CDS       T01001                                 

Gene name
CPA2
Definition
(RefSeq) carboxypeptidase A2
  KO
K01298  carboxypeptidase A2 [EC:3.4.17.15]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    1358 (CPA2)
   04974 Protein digestion and absorption
    1358 (CPA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1358 (CPA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.15  carboxypeptidase A2
     1358 (CPA2)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   1358 (CPA2)
SSDB
Motif
Pfam: Peptidase_M14 Propep_M14
Other DBs
NCBI-GeneID: 1358
NCBI-ProteinID: NP_001860
OMIM: 600688
HGNC: 2297
Ensembl: ENSG00000158516
Vega: OTTHUMG00000157019
Pharos: P48052(Tbio)
UniProt: P48052
Structure
PDB: 
1DTD 1AYE 1O6X

Position
7q32.2
AA seq 419 aa
MAMRLILFFGALFGHIYCLETFVGDQVLEIVPSNEEQIKNLLQLEAQEHLQLDFWKSPTT
PGETAHVRVPFVNVQAVKVFLESQGIAYSIMIEDVQVLLDKENEEMLFNRRRERSGNFNF
GAYHTLEEISQEMDNLVAEHPGLVSKVNIGSSFENRPMNVLKFSTGGDKPAIWLDAGIHA
REWVTQATALWTANKIVSDYGKDPSITSILDALDIFLLPVTNPDGYVFSQTKNRMWRKTR
SKVSGSLCVGVDPNRNWDAGFGGPGASSNPCSDSYHGPSANSEVEVKSIVDFIKSHGKVK
AFITLHSYSQLLMFPYGYKCTKLDDFDELSEVAQKAAQSLRSLHGTKYKVGPICSVIYQA
SGGSIDWSYDYGIKYSFAFELRDTGRYGFLLPARQILPTAEETWLGLKAIMEHVRDHPY
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggccatgaggttgatcctgttttttggtgccctttttgggcatatctactgtctagaa
acatttgtgggagaccaagttcttgagattgtaccaagcaatgaagaacaaattaaaaat
ctgctacaattggaggctcaagaacatctccagcttgatttttggaaatcacccaccacc
ccaggggagacagcccacgtccgagttcccttcgtcaacgtccaggcagtcaaagtgttc
ttggagtcccagggaattgcctattccatcatgattgaagacgtgcaggtcctgttggac
aaagagaatgaagaaatgctttttaataggagaagagaacggagtggtaacttcaatttt
ggggcctaccataccctggaagagatttcccaagaaatggataacctcgtggctgagcac
cctggtctagtgagcaaagtgaatattggctcttcttttgagaaccggcctatgaacgtg
ctcaagttcagcaccggaggagacaagccagctatctggctggatgctgggatccatgct
cgagagtgggttacacaagctacggcactttggacagcaaataagattgtttctgattat
ggaaaggacccatccatcacttccattctggatgccctggatatcttcctcctgccagtc
acaaaccctgatggatacgtgttctctcaaaccaaaaatcgtatgtggcggaagacccgg
tccaaggtatctggaagcctctgtgttggtgtggatcctaaccggaactgggatgcaggt
tttggaggacctggagccagcagcaacccttgctctgattcataccacggacccagtgcc
aactctgaagttgaagtgaaatccatagtggacttcatcaagagtcatggaaaagtcaag
gccttcattaccctccacagctattcccagctgctgatgttcccctatgggtacaaatgt
accaagttagatgactttgatgagctgagtgaagtggcccaaaaggctgcccaatctctg
agaagcctgcatggcaccaagtacaaagtgggaccaatctgctctgtcatctaccaagcc
agtggaggaagcattgactggtcctatgattatggcatcaagtactcatttgcctttgaa
ctgagagacacagggcgctacggcttcctcttgccagcccgtcagatcctgcccacagcc
gaggagacctggcttggcttgaaggcaatcatggagcatgtgcgagaccacccctattag

KEGG   Homo sapiens (human): 1359
Entry
1359              CDS       T01001                                 

Gene name
CPA3, MC-CPA
Definition
(RefSeq) carboxypeptidase A3
  KO
K08780  carboxypeptidase A3 [EC:3.4.17.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
hsa04972  Pancreatic secretion
hsa04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    1359 (CPA3)
  09154 Digestive system
   04972 Pancreatic secretion
    1359 (CPA3)
   04974 Protein digestion and absorption
    1359 (CPA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1359 (CPA3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     1359 (CPA3)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   1359 (CPA3)
SSDB
Motif
Pfam: Peptidase_M14 Propep_M14 GATase1_like
Other DBs
NCBI-GeneID: 1359
NCBI-ProteinID: NP_001861
OMIM: 114851
HGNC: 2298
Ensembl: ENSG00000163751
Vega: OTTHUMG00000159526
Pharos: P15088(Tchem)
UniProt: P15088
Position
3q24
AA seq 417 aa
MRLILPVGLIATTLAIAPVRFDREKVFRVKPQDEKQADIIKDLAKTNELDFWYPGATHHV
AANMMVDFRVSEKESQAIQSALDQNKMHYEILIHDLQEEIEKQFDVKEDIPGRHSYAKYN
NWEKIVAWTEKMMDKYPEMVSRIKIGSTVEDNPLYVLKIGEKNERRKAIFTDCGIHAREW
VSPAFCQWFVYQATKTYGRNKIMTKLLDRMNFYILPVFNVDGYIWSWTKNRMWRKNRSKN
QNSKCIGTDLNRNFNASWNSIPNTNDPCADNYRGSAPESEKETKAVTNFIRSHLNEIKVY
ITFHSYSQMLLFPYGYTSKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISG
SSLDWAYDLGIKHTFAFELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYILKHTS
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgaggctcatcctgcctgtgggtttgattgctaccactcttgcaattgctcctgtccgc
tttgacagggagaaggtgttccgcgtgaagccccaggatgaaaaacaagcagacatcata
aaggacttggccaaaaccaatgagcttgacttctggtatccaggtgccacccaccacgta
gctgctaatatgatggtggatttccgagttagtgagaaggaatcccaagccatccagtct
gccttggatcaaaataaaatgcactatgaaatcttgattcatgatctacaagaagagatt
gagaaacagtttgatgttaaagaagatatcccaggcaggcacagctacgcaaaatacaat
aattgggaaaagattgtggcttggactgaaaagatgatggataagtatcctgaaatggtc
tctcgtattaaaattggatctactgttgaagataatccactatatgttctgaagattggg
gaaaagaatgaaagaagaaaggctatttttacggattgtggcattcacgcacgagaatgg
gtctccccagcattctgccagtggtttgtctatcaggcaaccaaaacttatgggagaaac
aaaattatgaccaaactcttggaccgaatgaatttttacattcttcctgtgttcaatgtt
gatggatatatttggtcatggacaaagaaccgcatgtggagaaaaaatcgttccaagaac
caaaactccaaatgcatcggcactgacctcaacaggaattttaatgcttcatggaactcc
attcctaacaccaatgacccatgtgcagataactatcggggctctgcaccagagtccgag
aaagagacgaaagctgtcactaatttcattagaagccacctgaatgaaatcaaggtttac
atcaccttccattcctactcccagatgctattgtttccctatggatatacatcaaaactg
ccacctaaccatgaggacttggccaaagttgcaaagattggcactgatgttctatcaact
cgatatgaaacccgctacatctatggcccaatagaatcaacaatttacccgatatcaggt
tcttctttagactgggcttatgacctgggcatcaaacacacatttgcctttgagctccga
gataaaggcaaatttggttttctccttccagaatcccggataaagccaacgtgcagagag
accatgctagctgtcaaatttattgccaagtatatcctcaagcatacttcctaa

DBGET integrated database retrieval system