KEGG   Homo sapiens (human): 135886Help
Entry
135886            CDS       T01001                                 

Gene name
TMEM270, WBSCR28
Definition
(RefSeq) transmembrane protein 270
Organism
hsa  Homo sapiens (human)
Disease
H01439  Williams-Beuren syndrome
SSDB OrthologParalogGFIT
Motif
Pfam: WBS28
Motif
Other DBs
NCBI-GeneID: 135886
NCBI-ProteinID: NP_872310
OMIM: 612547
HGNC: 23018
Ensembl: ENSG00000175877
Vega: OTTHUMG00000157243
Pharos: Q6UE05(Tdark)
UniProt: Q6UE05
Position
7q11.23
AA seq 265 aa AA seqDB search
MEALPPVRSSLLGILLQVTRLSVLLVQNRDHLYNFLLLKINLFNHWVSGLAQEARGSCNW
QAHLPLGAAACPLGQALWAGLALIQVPVWLVLQGPRLMWAGMWGSTKGLGLALLSAWEQL
GLSVAIWTDLFLSCLHGLMLVALLLVVVTWRVCQKSHCFRLGRQLSKALQVNCVVRKLLV
QLRRLYWWVETMTALTSWHLAYLITWTTCLASHLLQAAFEHTTQLAEAQEVEPQEVSGSS
LLPSLSASSDSESGTVLPEQETPRE
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggaggcccttcctccagtcagatccagccttttggggatcctgttgcaggttacgagg
ctctcagtgctgttggttcagaaccgagatcacctctataatttcctgctcctcaagatc
aacctcttcaaccactgggtgtcagggctggcccaggaggcccgggggtcctgtaactgg
caggcccacctacccctgggagctgcagcctgccccctgggccaggctctctgggctggg
ctggctctgatacaggtccccgtatggctggtgctacagggacccaggctgatgtgggct
ggcatgtggggcagcaccaagggcctgggcctggccttgctcagtgcctgggagcagctg
ggcctgtctgtggccatctggacagatctgtttttgtcatgtctgcacggcctgatgttg
gtggccttgctcttggtggtagtgacctggagggtgtgtcagaagtcccactgcttccga
ctgggcaggcagctcagtaaggccttgcaagtgaactgcgtggtaaggaagctcctggta
cagctgagacgtctgtattggtgggtggagactatgactgccctcacctcctggcacctg
gcctatctcatcacctggaccacctgcctggcctcccacctgctgcaggctgcctttgag
cacacgacccagctggccgaggcccaggaggttgaaccccaggaggtctcagggtcttcc
ttgctgccctcactgtctgcgtcctcggactcagagtctggaacagttttgccagagcaa
gaaactcccagagaataa

DBGET integrated database retrieval system