KEGG   Homo sapiens (human): 135924Help
Entry
135924            CDS       T01001                                 

Gene name
OR9A2
Definition
(RefSeq) olfactory receptor family 9 subfamily A member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    135924 (OR9A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    135924 (OR9A2)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    135924 (OR9A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 135924
NCBI-ProteinID: NP_001001658
HGNC: 15093
Ensembl: ENSG00000179468
Vega: OTTHUMG00000158386
Pharos: Q8NGT5(Tdark)
UniProt: Q8NGT5
Position
7q34
AA seq 310 aa AA seqDB search
MMDNHSSATEFHLLGFPGSQGLHHILFAIFFFFYLVTLMGNTVIIVIVCVDKRLQSPMYF
FLSHLSTLEILVTTIIVPMMLWGLLFLGCRQYLSLHVSLNFSCGTMEFALLGVMAVDRYV
AVCNPLRYNIIMNSSTCIWVVIVSWVFGFLSEIWPIYATFQFTFRKSNSLDHFYCDRGQL
LKLSCDNTLLTEFILFLMAVFILIGSLIPTIVSYTYIISTILKIPSASGRRKAFSTFASH
FTCVVIGYGSCLFLYVKPKQTQGVEYNKIVSLLVSVLTPFLNPFIFTLRNDKVKEALRDG
MKRCCQLLKD
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgatggacaaccactctagtgccactgaattccaccttctaggcttccctgggtcccaa
ggactacaccacattctttttgctatattctttttcttctatttagtgacattaatggga
aacacggtcatcattgtgattgtctgtgtggataaacgtctgcagtcccccatgtatttc
ttcctcagccacctctctaccctggagatcctggtcacaaccataattgtccccatgatg
ctttggggattgctcttcctgggatgcagacagtatctttctctacatgtatcgctcaac
ttttcctgtgggaccatggagtttgcattacttggagtgatggctgtggaccgttatgtg
gctgtgtgtaaccctttgaggtacaacatcattatgaacagcagtacctgtatttgggtg
gtaatagtgtcatgggtgtttggatttctttctgaaatctggcccatctatgccacattt
cagtttaccttccgcaaatcaaattcattagaccatttttactgtgaccgagggcaattg
ctcaaactgtcctgcgataacactcttctcacagagtttatccttttcttaatggctgtt
tttattctcattggttctttgatccctacgattgtctcctacacctacattatctccacc
atcctcaagatcccgtcagcctctggccggaggaaagccttctccacttttgcctcccac
ttcacctgtgttgtgattggctatggcagctgcttgtttctctacgtgaaacccaagcaa
acacagggagttgagtacaataagatagtttccctgttggtttctgtgttaacccccttc
ctgaatcctttcatctttactcttcggaatgacaaagtcaaagaggccctccgagatggg
atgaaacgctgctgtcaactcctgaaagattag

DBGET integrated database retrieval system