KEGG   Homo sapiens (human): 135941Help
Entry
135941            CDS       T01001                                 

Gene name
OR2A14, OR2A14P, OR2A6, OST182
Definition
(RefSeq) olfactory receptor family 2 subfamily A member 14
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    135941 (OR2A14)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    135941 (OR2A14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 135941
NCBI-ProteinID: NP_001001659
HGNC: 15084
Ensembl: ENSG00000221938
Vega: OTTHUMG00000158003
Pharos: Q96R47(Tdark)
UniProt: Q96R47 A0A126GVB0
Position
7q35
AA seq 310 aa AA seqDB search
MEGNKTWITDITLPRFQVGPALEILLCGLFSAFYTLTLLGNGVIFGIICLDCKLHTPMYF
FLSHLAIVDISYASNYVPKMLTNLMNQESTISFFPCIMQTFLYLAFAHVECLILVVMSYD
RYADICHPLRYNSLMSWRVCTVLAVASWVFSFLLALVPLVLILSLPFCGPHEINHFFCEI
LSVLKLACADTWLNQVVIFAACVFILVGPLCLVLVSYLRILAAILRIQSGEGRRKAFSTC
SSHLCVVGLFFGSAIVTYMAPKSRHPEEQQKVLSLFYSLFNPMLNPLIYSLRNAEVKGAL
RRALRKERLT
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggaaggcaacaagacatggatcacagacatcaccttgccgcgattccaggttggtcca
gcactggagattctcctctgtggacttttctctgccttctatacactcaccctgctgggg
aatggggtcatctttgggattatctgcctggactgtaagcttcacacacccatgtacttc
ttcctctcacacctggccattgttgacatatcctatgcttccaactatgtccccaagatg
ctgacgaatcttatgaaccaggaaagcaccatctccttttttccatgcataatgcagaca
ttcttgtatttggcttttgctcacgtagagtgtctgattttggtggtgatgtcctatgat
cgctatgcggacatctgccaccccttacgttacaatagcctcatgagctggagagtgtgc
actgtcctggctgtggcttcctgggtgttcagcttcctcctggctctggtccctttagtt
ctcatcctgagcctgcccttctgcgggcctcatgaaatcaaccacttcttctgtgaaatc
ctgtctgtcctcaagttggcctgtgctgacacctggctcaaccaggtggtcatctttgca
gcctgcgtgttcatcctggtggggccactctgcctggtgctggtctcctacttgcgcatc
ctggccgccatcttgaggatccagtctggggagggccgcagaaaggccttctccacctgc
tcctcccacctttgcgtggtgggactcttctttggcagcgccattgtcacgtacatggcc
cccaagtcccgccatcctgaggagcagcagaaagttctttccctgttttacagccttttc
aatccaatgctgaaccccctgatatatagcctaaggaatgcagaggtcaagggcgccctg
aggagggcactgaggaaggagaggctgacgtga

DBGET integrated database retrieval system