KEGG   Homo sapiens (human): 136Help
Entry
136               CDS       T01001                                 

Gene name
ADORA2B, ADORA2
Definition
(RefSeq) adenosine A2b receptor
  KO
K04267  adenosine receptor A2b
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
hsa05034  Alcoholism
Drug target
Adenosine (DG00243): D00045 D02300 D02769 D08646 D08647
Aminophylline (DG01062): D00227 D05429 D11630
Diprophylline: D00691
Enprofylline: D04006
Proxyphylline: D01771
Theophylline (DG01061): D00371 D01712 D06103 D06104
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    136 (ADORA2B)
   04020 Calcium signaling pathway
    136 (ADORA2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    136 (ADORA2B)
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    136 (ADORA2B)
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    136 (ADORA2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    136 (ADORA2B)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    136 (ADORA2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx GPR_Gpa2_C 7TM_GPCR_Sri
Motif
Other DBs
NCBI-GeneID: 136
NCBI-ProteinID: NP_000667
OMIM: 600446
HGNC: 264
Ensembl: ENSG00000170425
Vega: OTTHUMG00000059140
Pharos: P29275(Tclin)
UniProt: P29275
Position
17p12
AA seq 332 aa AA seqDB search
MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA
IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT
RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS
YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV
GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT
FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggagacacaggacgcgctgtacgtggcgctggagctggtcatcgccgcgctt
tcggtggcgggcaacgtgctggtgtgcgccgcggtgggcacggcgaacactctgcagacg
cccaccaactacttcctggtgtccctggctgcggccgacgtggccgtggggctcttcgcc
atcccctttgccatcaccatcagcctgggcttctgcactgacttctacggctgcctcttc
ctcgcctgcttcgtgctggtgctcacgcagagctccatcttcagccttctggccgtggca
gtcgacagatacctggccatctgtgtcccgctcaggtataaaagtttggtcacggggacc
cgagcaagaggggtcattgctgtcctctgggtccttgcctttggcatcggattgactcca
ttcctggggtggaacagtaaagacagtgccaccaacaactgcacagaaccctgggatgga
accacgaatgaaagctgctgccttgtgaagtgtctctttgagaatgtggtccccatgagc
tacatggtatatttcaatttctttgggtgtgttctgcccccactgcttataatgctggtg
atctacattaagatcttcctggtggcctgcaggcagcttcagcgcactgagctgatggac
cactcgaggaccaccctccagcgggagatccatgcagccaagtcactggccatgattgtg
gggatttttgccctgtgctggttacctgtgcatgctgttaactgtgtcactcttttccag
ccagctcagggtaaaaataagcccaagtgggcaatgaatatggccattcttctgtcacat
gccaattcagttgtcaatcccattgtctatgcttaccggaaccgagacttccgctacact
tttcacaaaattatctccaggtatcttctctgccaagcagatgtcaagagtgggaatggt
caggctggggtacagcctgctctcggtgtgggcctatga

DBGET integrated database retrieval system