KEGG   Homo sapiens (human): 1362
Entry
1362              CDS       T01001                                 
Symbol
CPD, GP180
Name
(RefSeq) carboxypeptidase D
  KO
K07752  carboxypeptidase D [EC:3.4.17.22]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1362 (CPD)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.22  metallocarboxypeptidase D
     1362 (CPD)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   1362 (CPD)
SSDB
Motif
Pfam: Peptidase_M14 CarboxypepD_reg CarbopepD_reg_2 AstE_AspA PEGA Phage_tube_C
Other DBs
NCBI-GeneID: 1362
NCBI-ProteinID: NP_001295
OMIM: 603102
HGNC: 2301
Ensembl: ENSG00000108582
Pharos: O75976(Tbio)
UniProt: O75976
Structure
Position
17:30378927..30469989
AA seq 1380 aa
MASGRDERPPWRLGRLLLLMCLLLLGSSARAAHIKKAEATTTTTSAGAEAAEGQFDRYYH
EEELESALREAAAAGLPGLARLFSIGRSVEGRPLWVLRLTAGLGSLIPEGDAGPDAAGPD
AAGPLLPGRPQVKLVGNMHGDETVSRQVLIYLARELAAGYRRGDPRLVRLLNTTDVYLLP
SLNPDGFERAREGDCGFGDGGPSGASGRDNSRGRDLNRSFPDQFSTGEPPALDEVPEVRA
LIEWIRRNKFVLSGNLHGGSVVASYPFDDSPEHKATGIYSKTSDDEVFKYLAKAYASNHP
IMKTGEPHCPGDEDETFKDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPAS
QLRQEWENNRESLITLIEKVHIGVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFY
RLLVPGTYNLTVVLTGYMPLTVTNVVVKEGPATEVDFSLRPTVTSVIPDTTEAVSTASTV
AIPNILSGTSSSYQPIQPKDFHHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYV
MEISDNPGVHEPGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVHNTRI
HLMPSMNPDGYEKSQEGDSISVIGRNNSNNFDLNRNFPDQFVQITDPTQPETIAVMSWMK
SYPFVLSANLHGGSLVVNYPFDDDEQGLATYSKSPDDAVFQQIALSYSKENSQMFQGRPC
KNMYPNEYFPHGITNGASWYNVPGGMQDWNYLQTNCFEVTIELGCVKYPLEKELPNFWEQ
NRRSLIQFMKQVHQGVRGFVLDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGTY
KITASARGYNPVTKNVTVKSEGAIQVNFTLVRSSTDSNNESKKGKGASSSTNDASDPTTK
EFETLIKDLSAENGLESLMLRSSSNLALALYRYHSYKDLSEFLRGLVMNYPHITNLTNLG
QSTEYRHIWSLEISNKPNVSEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKKNPA
VTQLVDRTRIVIVPSLNPDGRERAQEKDCTSKIGQTNARGKDLDTDFTNNASQPETKAII
ENLIQKQDFSLSVALDGGSMLVTYPYDKPVQTVENKETLKHLASLYANNHPSMHMGQPSC
PNKSDENIPGGVMRGAEWHSHLGSMKDYSVTYGHCPEITVYTSCCYFPSAARLPSLWADN
KRSLLSMLVEVHKGVHGFVKDKTGKPISKAVIVLNEGIKVQTKEGGYFHVLLAPGVHNII
AIADGYQQQHSQVFVHHDAASSVVIVFDTDNRIFGLPRELVVTVSGATMSALILTACIIW
CICSIKSNRHKDGFHRLRQHHDEYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSKH
NT seq 4143 nt   +upstreamnt  +downstreamnt
atggcgagcggccgggacgagcggccgccttggcggctagggcggctcctgttgctcatg
tgcctgctgctgctggggagctcggcccgggcggctcacatcaagaaggcggaggcgact
accacaactacgagcgcgggcgccgaggcggccgagggccagttcgaccgctactaccac
gaagaggagttggagtcggcgctgagggaggcggcggccgcgggcctccccggcctggcc
cgcctctttagcatcggccgctcggtggaaggccggccgctgtgggtgcttcgcctcacc
gccggcctggggtcgctaatccctgagggcgacgcggggcctgacgctgccgggcccgac
gctgcggggccgctgctgcccggccggccccaggtgaagctggtgggcaacatgcatggc
gacgagaccgtgtcgcgccaggtgttgatctacttggcccgcgagctggcggccggctac
cgccgcggggacccgcgcctggtccgcctgctcaacaccaccgacgtgtacctgctgccc
agcctcaaccccgatggcttcgagcgtgcccgcgagggcgactgtggcttcggcgacggc
ggcccgtccggggccagcggccgcgacaatagtcgcggccgcgacctcaaccgaagcttt
cccgaccagtttagcaccggcgaaccccccgccctggacgaggtgcccgaggtgcgcgcc
ctcatcgagtggatccgcaggaacaagtttgtgctttctggaaatctgcatggtggctca
gtggtagcaagctatccttttgatgattctccagaacataaggccactggaatctatagc
aaaacctcagatgatgaagtatttaaatacttggcaaaagcttatgcttcaaaccacccc
ataatgaaaactggtgagcctcattgtccaggagatgaagacgagactttcaaagatgga
atcacaaacggcgcacattggtatgatgtggaaggtggtatgcaagattacaattatgtg
tgggccaactgttttgagatcacattagaactgtcttgttgcaagtacccacctgcttca
cagcttcgacaggaatgggagaacaatcgtgagtctttgatcacattgattgaaaaggtt
cacattggagtgaaaggatttgttaaagattccataacaggatctgggttagagaatgca
accatctcagtggctggtattaatcataatatcacaacaggcagatttggtgatttctac
cgattacttgttcctggaacttacaaccttacagtagttttaactgggtatatgccattg
actgttactaatgtagtggtgaaagaaggaccagccacagaggtggatttttctcttagg
ccaactgtaacttcagtaatccctgacacgacagaggctgtatcaactgctagcacagtt
gctatacctaatattctttctggaacatcatcctcctaccagccaattcagccaaaggac
tttcaccaccaccatttccctgatatggaaatcttcttgagaaggtttgccaatgaatat
cctaacattacccggctttattccttgggaaaatcagtagagtcaagagaactttatgtg
atggagatatctgataatccgggtgtccatgaaccaggtgaaccagaatttaagtacatt
ggaaatatgcatggaaatgaagtggttggaagagaactgctgttgaacctcatagaatac
ctttgtaagaactttggaacagaccctgaagtcacagatttggttcataacactagaatt
caccttatgccatccatgaatcctgatgggtatgaaaagtcccaggaaggagattcaata
agtgtaattggcagaaacaacagcaacaactttgacctgaaccgaaatttcccagaccag
tttgttcagatcacagatcctacgcaaccagaaactattgctgtaatgagctggatgaag
tcctatccatttgtactttcagcaaacctgcatggaggttctttggtggttaactaccct
tttgatgatgatgaacaaggacttgccacatatagtaaatcaccagatgatgctgtgttc
caacaaatagcactttcttattccaaggaaaattcccagatgtttcaaggtagaccttgc
aagaatatgtatcctaatgaatattttcctcatggaataacaaatggagctagttggtat
aatgtgccaggaggaatgcaggactggaactatttacaaacaaattgctttgaagtgact
attgaactaggttgtgtgaaatatccacttgagaaagagctgccaaacttttgggaacag
aatcgaagatcactaatccagtttatgaaacaggttcatcagggcgtcagaggatttgtt
ctagatgccacagatggcaggggtatattaaatgccaccattagtgttgctgagattaat
cacccagtgactacttacaaaactggagattactggcgtctcttggttccaggaacttat
aaaatcacagcatctgctcgagggtataatccagttaccaagaatgtgactgtcaagagt
gaaggcgctattcaggtcaacttcacacttgttcgatcctcaacagattcaaacaatgaa
tcaaagaaaggaaaaggggctagcagcagcaccaatgatgccagtgatccaactactaaa
gagtttgaaactttaattaaagacctttcagcggagaatggtttggaaagcctcatgtta
cgctcctcctcaaatctggctctggctctttatcgataccattcctacaaagacttatca
gagtttctgagaggacttgtaatgaactatccacatattacaaatcttaccaatttggga
cagagcactgaatatcgtcacatttggtcccttgaaatctccaataagcccaatgtatct
gagcctgaagaaccaaagattcgttttgttgctggtatccatggaaatgcgccagttgga
actgaactgcttttggctctggcagaatttctctgcctgaactacaaaaagaacccagct
gttacccaattggttgacaggactaggattgtgattgtcccttctctaaatccagatggg
cgagagagagctcaagagaaagactgtacttcaaaaataggacaaacaaatgctcgtggc
aaagatttggatacagacttcacaaataatgcctcccaacctgagaccaaagccatcatt
gaaaatttgattcaaaaacaggactttagtctttctgttgccttagatggtggttccatg
ctggtcacatatccttatgacaagccagtacagacagtggaaaataaagagactctgaag
catttggcatctctttatgcaaataatcatccatccatgcacatgggtcagcccagttgc
ccaaataaatcagatgagaatattccaggaggagtaatgcgtggagcagaatggcatagt
cacctgggcagcatgaaggattatagtgtcacctatggccattgtccggaaatcacagta
tacacaagctgctgttactttcctagtgctgcacgactcccttccttgtgggcagacaat
aagagatctcttcttagtatgttagtggaggttcacaagggagttcatggatttgttaaa
gataagactggaaagccaatctctaaagcagtcattgtacttaatgaaggaataaaggta
caaacaaaagagggaggttatttccatgtactcttagcgccaggtgtccataacattatt
gccatcgctgatgggtaccagcaacaacattcacaggtctttgtgcatcatgatgcagct
agttctgtggtgatagtctttgacacagataaccggatatttggtttgccaagggagctt
gtggtaactgtatcaggtgctactatgtcggcattgatcctaacagcttgcattatttgg
tgcatctgctcaatcaagtctaatagacacaaggatggctttcatcggctcaggcagcat
catgatgagtatgaagatgaaattcgcatgatgtctaccggctccaagaagtccctccta
agccatgagttccaggatgaaacagacactgaagaggaaacattatattctagcaaacat
tga

DBGET integrated database retrieval system