KEGG   Homo sapiens (human): 136227Help
Entry
136227            CDS       T01001                                 

Gene name
COL26A1, EMI6, EMID2, EMU2, SH2B
Definition
(RefSeq) collagen type XXVI alpha 1 chain
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen EMI
Motif
Other DBs
NCBI-GeneID: 136227
NCBI-ProteinID: NP_001265492
OMIM: 608927
HGNC: 18038
Ensembl: ENSG00000160963
Vega: OTTHUMG00000150033
Pharos: Q96A83(Tdark)
UniProt: Q96A83
Position
7q22.1
AA seq 441 aa AA seqDB search
MKLALLLPWACCCLCGSALATGFLYPFSAAALQQHGYPEPGAGSPGSGYASRRHWCHHTV
TRTVSCQVQNGSETVVQRVYQSCRWPGPCANLVSYRTLIRPTYRVSYRTVTVLEWRCCPG
FTGSNCDEECMNCTRLSDMSERLTTLEAKVLLLEAAERPSSPDNDLPAPESTPPTWNEDF
LPDAIPLAHPVPRQRRPTGPAGPPGQTGPPGPAGPPGSKGDRGQTGEKGPAGPPGLLGPP
GPRGLPGEMGRPGPPGPPGPAGNPGPSPNSPQGALYSLQPPTDKDNGDSRLASAIVDTVL
AGVPGPRGPPGPPGPPGPRGPPGPPGTPGSQGLAGERGTVGPSGEPGVKGEEGEKAATAE
GEGVQQLREALKILAERVLILEHMIGIHDPLASPEGGSGQDAALRANLKMKRGGAQPDGV
LAALLGPDPGQKSVDQASSRK
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggccctgctcctgccctgggcgtgttgctgcctctgcgggtcggcgctggcc
accggcttcctctatcccttctcggccgcagctctgcagcagcacggctaccccgagccc
ggcgccggctcccctggcagcggctacgcgagccgccggcactggtgccatcacacagtg
acacggacggtgtcctgccaggtgcagaatggctcggagacggtggtccagcgcgtgtac
cagagctgccggtggccggggccctgcgccaacctcgtaagttacaggactctgatcaga
cccacctacagagtgtcctaccgcacggtgacggtgctggagtggagatgctgccctggc
ttcaccgggagcaactgtgatgaggaatgcatgaactgcacccggctcagtgacatgagt
gagcgactgaccacactggaggccaaggtcctcctgctagaagcagcagaacggccctcc
agcccggacaacgacctgccagcccccgagagcactccgccgacctggaatgaggacttc
ctccccgacgccatccctcttgctcaccctgtgccacgacagagaaggcccacgggccca
gccgggcccccggggcagacaggaccaccagggcctgcaggcccccccgggtctaaaggt
gaccgaggccagacaggagagaagggtccagcggggccgcctgggctcctggggcctcca
gggccccgtgggcttcctggagagatggggcgccccggccccccaggaccacccggccca
gcaggcaacccaggcccctcaccaaacagcccccagggcgccctctactccctgcagccg
cctacagacaaagacaatggagactcaaggctggcctctgccatcgtggacacagtgctg
gcaggtgtcccaggaccccggggtccccctggtccaccaggtccccctgggcctcgaggt
cccccaggacccccaggaacacctggatcccagggcctggctggagagcgaggcacagtg
gggccgtccggtgaacctggcgtgaagggggaagaaggagagaaagccgccactgcagag
ggcgagggggtgcagcagctgagagaggccctgaagatcctggcagagcgagtcctcatc
ctggagcacatgattgggatccacgatcccctggcctccccagagggaggttctggccag
gatgctgccctgagagccaacctcaagatgaagaggggtggcgcccaacccgatggggtc
cttgctgccctgcttgggcccgaccctggacagaagagcgtggaccaggccagcagcagg
aagtga

DBGET integrated database retrieval system