KEGG   Homo sapiens (human): 1363
Entry
1363              CDS       T01001                                 

Gene name
CPE, CPH
Definition
(RefSeq) carboxypeptidase E
  KO
K01294  carboxypeptidase E [EC:3.4.17.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04940  Type I diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    1363 (CPE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1363 (CPE)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.10  carboxypeptidase E
     1363 (CPE)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   1363 (CPE)
SSDB
Motif
Pfam: Peptidase_M14 CarboxypepD_reg CarbopepD_reg_2 AstE_AspA
Other DBs
NCBI-GeneID: 1363
NCBI-ProteinID: NP_001864
OMIM: 114855
HGNC: 2303
Ensembl: ENSG00000109472
Vega: OTTHUMG00000150252
Pharos: P16870(Tbio)
UniProt: P16870 A0A384N679
Position
4q32.3
AA seq 476 aa
MAGRGGSALLALCGALAACGWLLGAEAQEPGAPAAGMRRRRRLQQEDGISFEYHRYPELR
EALVSVWLQCTAISRIYTVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVG
RELLIFLAQYLCNEYQKGNETIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRS
NAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNMKKIVDQNTKLAPETKAVIHWIMDIP
FVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPC
RKNDDDSSFVDGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWED
NKNSLISYLEQIHRGVKGFVRDLQGNPIANATISVEGIDHDVTSAKDGDYWRLLIPGNYK
LTASAPGYLAITKKVAVPYSPAAGVDFELESFSERKEEEKEELMEWWKMMSETLNF
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggccgggcgagggggcagcgcgctgctggctctgtgcggggcactggctgcctgcggg
tggctcctgggcgccgaagcccaggagcccggggcgcccgcggcgggcatgaggcggcgc
cggcggctgcagcaagaggacggcatctccttcgagtaccaccgctaccccgagctgcgc
gaggcgctcgtgtccgtgtggctgcagtgcaccgccatcagcaggatttacacggtgggg
cgcagcttcgagggccgggagctcctggtcatcgagctgtccgacaaccctggcgtccat
gagcctggtgagcctgaatttaaatacattgggaatatgcatgggaatgaggctgttgga
cgagaactgctcattttcttggcccagtacctatgcaacgaataccagaaggggaacgag
acaattgtcaacctgatccacagtacccgcattcacatcatgccttccctgaacccagat
ggctttgagaaggcagcgtctcagcctggtgaactcaaggactggtttgtgggtcgaagc
aatgcccagggaatagatctgaaccggaactttccagacctggataggatagtgtacgtg
aatgagaaagaaggtggtccaaataatcatctgttgaaaaatatgaagaaaattgtggat
caaaacacaaagcttgctcctgagaccaaggctgtcattcattggattatggatattcct
tttgtgctttctgccaatctccatggaggagaccttgtggccaattatccatatgatgag
acgcggagtggtagtgctcacgaatacagctcctccccagatgacgccattttccaaagc
ttggcccgggcatactcttctttcaacccggccatgtctgaccccaatcggccaccatgt
cgcaagaatgatgatgacagcagctttgtagatggaaccaccaacggtggtgcttggtac
agcgtacctggagggatgcaagacttcaattaccttagcagcaactgttttgagatcacc
gtggagcttagctgtgagaagttcccacctgaagagactctgaagacctactgggaggat
aacaaaaactccctcattagctaccttgagcagatacaccgaggagttaaaggatttgtc
cgagaccttcaaggtaacccaattgcgaatgccaccatctccgtggaaggaatagaccac
gatgttacatccgcaaaggatggtgattactggagattgcttatacctggaaactataaa
cttacagcctcagctccaggctatctggcaataacaaagaaagtggcagttccttacagc
cctgctgctggggttgattttgaactggagtcattttctgaaaggaaagaagaggagaag
gaagaattgatggaatggtggaaaatgatgtcagaaactttaaatttttaa

DBGET integrated database retrieval system