KEGG   Homo sapiens (human): 1365Help
Entry
1365              CDS       T01001                                 

Gene name
CLDN3, C7orf1, CPE-R2, CPETR2, HRVP1, RVP1
Definition
(RefSeq) claudin 3
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    1365 (CLDN3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    1365 (CLDN3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    1365 (CLDN3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    1365 (CLDN3)
  09172 Infectious disease: viral
   05160 Hepatitis C
    1365 (CLDN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1365 (CLDN3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   1365 (CLDN3)
  Exosomal proteins of colorectal cancer cells
   1365 (CLDN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 TMEM37 L_HMGIC_fpl
Motif
Other DBs
NCBI-GeneID: 1365
NCBI-ProteinID: NP_001297
OMIM: 602910
HGNC: 2045
Ensembl: ENSG00000165215
Vega: OTTHUMG00000023424
Pharos: O15551(Tbio)
UniProt: O15551 Q75L79
Position
7q11.23
AA seq 220 aa AA seqDB search
MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQ
MQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA
GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALL
CCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgggcctggagatcacgggcaccgcgctggccgtgctgggctggctgggcacc
atcgtgtgctgcgcgttgcccatgtggcgcgtgtcggccttcatcggcagcaacatcatc
acgtcgcagaacatctgggagggcctgtggatgaactgcgtggtgcagagcaccggccag
atgcagtgcaaggtgtacgactcgctgctggcactgccacaggaccttcaggcggcccgc
gccctcatcgtggtggccatcctgctggccgccttcgggctgctagtggcgctggtgggc
gcccagtgcaccaactgcgtgcaggacgacacggccaaggccaagatcaccatcgtggca
ggcgtgctgttccttctcgccgccctgctcaccctcgtgccggtgtcctggtcggccaac
accattatccgggacttctacaaccccgtggtgcccgaggcgcagaagcgcgagatgggc
gcgggcctgtacgtgggctgggcggccgcggcgctgcagctgctggggggcgcgctgctc
tgctgctcgtgtcccccacgcgagaagaagtacacggccaccaaggtcgtctactccgcg
ccgcgctccaccggcccgggagccagcctgggcacaggctacgaccgcaaggactacgtc
taa

DBGET integrated database retrieval system