KEGG   Homo sapiens (human): 1365
Entry
1365              CDS       T01001                                 
Symbol
CLDN3, C7orf1, CPE-R2, CPETR2, HRVP1, RVP1
Name
(RefSeq) claudin 3
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    1365 (CLDN3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    1365 (CLDN3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    1365 (CLDN3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    1365 (CLDN3)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    1365 (CLDN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    1365 (CLDN3)
   04147 Exosome [BR:hsa04147]
    1365 (CLDN3)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   1365 (CLDN3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   1365 (CLDN3)
  Exosomal proteins of colorectal cancer cells
   1365 (CLDN3)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 L_HMGIC_fpl TMEM37 Phage_holin_3_6 DUF6239
Other DBs
NCBI-GeneID: 1365
NCBI-ProteinID: NP_001297
OMIM: 602910
HGNC: 2045
Ensembl: ENSG00000165215
Pharos: O15551(Tbio)
UniProt: O15551 Q75L79
Position
7:complement(73768997..73770270)
AA seq 220 aa
MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNIITSQNIWEGLWMNCVVQSTGQ
MQCKVYDSLLALPQDLQAARALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA
GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMGAGLYVGWAAAALQLLGGALL
CCSCPPREKKYTATKVVYSAPRSTGPGASLGTGYDRKDYV
NT seq 663 nt   +upstreamnt  +downstreamnt
atgtccatgggcctggagatcacgggcaccgcgctggccgtgctgggctggctgggcacc
atcgtgtgctgcgcgttgcccatgtggcgcgtgtcggccttcatcggcagcaacatcatc
acgtcgcagaacatctgggagggcctgtggatgaactgcgtggtgcagagcaccggccag
atgcagtgcaaggtgtacgactcgctgctggcactgccacaggaccttcaggcggcccgc
gccctcatcgtggtggccatcctgctggccgccttcgggctgctagtggcgctggtgggc
gcccagtgcaccaactgcgtgcaggacgacacggccaaggccaagatcaccatcgtggca
ggcgtgctgttccttctcgccgccctgctcaccctcgtgccggtgtcctggtcggccaac
accattatccgggacttctacaaccccgtggtgcccgaggcgcagaagcgcgagatgggc
gcgggcctgtacgtgggctgggcggccgcggcgctgcagctgctggggggcgcgctgctc
tgctgctcgtgtcccccacgcgagaagaagtacacggccaccaaggtcgtctactccgcg
ccgcgctccaccggcccgggagccagcctgggcacaggctacgaccgcaaggactacgtc
taa

DBGET integrated database retrieval system