KEGG   Homo sapiens (human): 1366
Entry
1366              CDS       T01001                                 
Symbol
CLDN7, CEPTRL2, CLDN-7, CPETRL2, Hs.84359, claudin-1
Name
(RefSeq) claudin 7
  KO
K06087  claudin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa05130  Pathogenic Escherichia coli infection
hsa05160  Hepatitis C
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01287  Tight junction-Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    1366 (CLDN7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    1366 (CLDN7)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    1366 (CLDN7)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    1366 (CLDN7)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    1366 (CLDN7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    1366 (CLDN7)
   04147 Exosome [BR:hsa04147]
    1366 (CLDN7)
Cilium and associated proteins [BR:hsa03037]
 Other cilia and associated proteins
  Stereociliary proteins
   1366 (CLDN7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of ovarian cancer cells
   1366 (CLDN7)
  Exosomal proteins of colorectal cancer cells
   1366 (CLDN7)
SSDB
Motif
Pfam: PMP22_Claudin Claudin_2 SUR7 Clc-like Amastin OppC_N
Other DBs
NCBI-GeneID: 1366
NCBI-ProteinID: NP_001171951
OMIM: 609131
HGNC: 2049
Ensembl: ENSG00000181885
Pharos: O95471(Tbio)
UniProt: O95471 A0A384ME58
Position
17:complement(7259903..7263213)
AA seq 211 aa
MANSGLQLLGFSMALLGWVGLVACTAIPQWQMSSYAGDNIITAQAMYKGLWMDCVTQSTG
MMSCKMYDSVLALSAALQATRALMVVSLVLGFLAMFVATMGMKCTRCGGDDKVKKARIAM
GGGIIFIVAGLAALVACSWYGHQIVTDFYNPLIPTNIKYEFGPAIFIGWAGSALVILGGA
LLSCSCPGNESKAGYRVPRSYPKSNSSKEYV
NT seq 636 nt   +upstreamnt  +downstreamnt
atggccaattcgggcctgcagttgctgggcttctccatggccctgctgggctgggtgggt
ctggtggcctgcaccgccatcccgcagtggcagatgagctcctatgcgggtgacaacatc
atcacggcccaggccatgtacaaggggctgtggatggactgcgtcacgcagagcacgggg
atgatgagctgcaaaatgtacgactcggtgctcgccctgtccgcggccttgcaggccact
cgagccctaatggtggtctccctggtgctgggcttcctggccatgtttgtggccacgatg
ggcatgaagtgcacgcgctgtgggggagacgacaaagtgaagaaggcccgtatagccatg
ggtggaggcataattttcatcgtggcaggtcttgccgccttggtagcttgctcctggtat
ggccatcagattgtcacagacttttataaccctttgatccctaccaacattaagtatgag
tttggccctgccatctttattggctgggcagggtctgccctagtcatcctgggaggtgca
ctgctctcctgttcctgtcctgggaatgagagcaaggctgggtaccgtgtaccccgctct
taccctaagtccaactcttccaaggagtatgtgtga

DBGET integrated database retrieval system