KEGG   Homo sapiens (human): 1368
Entry
1368              CDS       T01001                                 

Gene name
CPM
Definition
(RefSeq) carboxypeptidase M
  KO
K01296  carboxypeptidase M [EC:3.4.17.12]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    1368 (CPM)
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    1368 (CPM)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.12  carboxypeptidase M
     1368 (CPM)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M14: carboxypeptidase A family
   1368 (CPM)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  1368 (CPM)
SSDB
Motif
Pfam: Peptidase_M14 CarboxypepD_reg AstE_AspA Dioxygenase_C
Other DBs
NCBI-GeneID: 1368
NCBI-ProteinID: NP_001005502
OMIM: 114860
HGNC: 2311
Ensembl: ENSG00000135678
Vega: OTTHUMG00000169300
Pharos: P14384(Tchem)
UniProt: P14384
Structure
PDB: 
1UWY

Position
12q15
AA seq 443 aa
MDFPCLWLGLLLPLVAALDFNYHRQEGMEAFLKTVAQNYSSVTHLHSIGKSVKGRNLWVL
VVGRFPKEHRIGIPEFKYVANMHGDETVGRELLLHLIDYLVTSDGKDPEITNLINSTRIH
IMPSMNPDGFEAVKKPDCYYSIGRENYNQYDLNRNFPDAFEYNNVSRQPETVAVMKWLKT
ETFVLSANLHGGALVASYPFDNGVQATGALYSRSLTPDDDVFQYLAHTYASRNPNMKKGD
ECKNKMNFPNGVTNGYSWYPLQGGMQDYNYIWAQCFEITLELSCCKYPREEKLPSFWNNN
KASLIEYIKQVHLGVKGQVFDQNGNPLPNVIVEVQDRKHICPYRTNKYGEYYLLLLPGSY
IINVTVPGHDPHITKVIIPEKSQNFSALKKDILLPFQGQLDSIPVSNPSCPMIPLYRNLP
DHSAATKPSLFLFLVSLLHIFFK
NT seq 1332 nt   +upstreamnt  +downstreamnt
atggacttcccgtgcctctggctagggctgttgctgcctttggtagctgcgctggatttc
aactaccaccgccaggaagggatggaagcgtttttgaagactgttgcccaaaactacagt
tctgtcactcacttacacagtattgggaaatctgtgaaaggtagaaacctgtgggttctt
gttgtggggcggtttccaaaggaacacagaattgggattccagagttcaaatacgtggca
aatatgcatggagatgagactgttgggcgggagctgctgctccatctgattgactatctc
gtaaccagtgatggcaaagaccctgaaatcacaaatctgatcaatagtacccggatacac
atcatgccttccatgaacccagatggatttgaagccgtcaaaaagcctgactgttattac
agcatcggaagggaaaattataaccagtatgacttgaatcgaaatttccccgatgctttt
gaatataataatgtctcaaggcagcctgaaactgtggcagtcatgaagtggctgaaaaca
gagacgtttgtcctctctgcaaacctccatggtggtgccctcgtggccagttacccattt
gataatggtgttcaagcaactggggcattatactcccgaagcttaacgcctgatgatgat
gtttttcaatatcttgcacatacctatgcttcaagaaatcccaacatgaagaaaggagac
gagtgtaaaaacaaaatgaactttcctaatggtgttacaaatggatactcttggtatcca
ctccaaggtggaatgcaagattacaactacatctgggcccagtgttttgaaattacgttg
gagctgtcatgctgtaaatatcctcgtgaggagaagcttccatccttttggaataataac
aaagcctcattaattgaatatataaagcaggtgcacctaggtgtaaagggtcaagttttt
gatcagaatggaaatccattacccaatgtaattgtggaagtccaagacagaaaacatatc
tgcccctatagaaccaacaaatatggagagtattatctccttctcttgcctgggtcttat
ataataaatgttacagtccctggacatgatccacacatcacaaaggtgattattccggag
aaatcccagaacttcagtgctcttaaaaaggatattctacttccattccaagggcaattg
gattctatcccagtatcaaatccttcatgcccaatgattcctctatacagaaatttgcca
gaccactcagctgcaacaaagcctagtttgttcttatttttagtgagtcttttgcacata
ttcttcaaataa

DBGET integrated database retrieval system