KEGG   Homo sapiens (human): 136895
Entry
136895            CDS       T01001                                 
Symbol
C7orf31
Name
(RefSeq) chromosome 7 open reading frame 31
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4555
Other DBs
NCBI-GeneID: 136895
NCBI-ProteinID: NP_620166
OMIM: 616071
HGNC: 21722
Ensembl: ENSG00000153790
Pharos: Q8N865(Tdark)
UniProt: Q8N865
Position
7:complement(25125772..25180354)
AA seq 590 aa
MEVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRESLQQCRLPW
GAEREYGGIIPISLPEDHRPKYEPPRVMGKGHQHYGFGGETWPRKLPVEQFYYLTQNKKS
DVYGNDSLIPKPPNSTVGEICLPYPIEHPYHTHICRGAMFPTFTSPEDLYTGIKARTQQP
FPPTVPTKAYDSTVLKTRGNPYRYELIDIPMDSKKKALTWPGQGVYYDFPRGVEKNKPVF
YPKPPKTFAPNTSLNSWDPICSAKEANIQRNLERSHWLTSYTHDFTGLGPMDPLELDDYH
EKMVAELTRKIGFDPEPQEKFHPVFKPPRPLEGRIARLIQNRRSLEAIVQQRPRSCPDCT
PRVLCNFHTFVPSSKEMVALSDNIPAGVTHKNQDIEEKIIEEQSLLSTYELPSCYPTKDL
TSIYDIKPFPKITDTKKTEDLYWRQQSLKTQPTPYCKPDHWIHYENLKSPLRDQYNMCPD
PVSLSKPSVLQNKQDTEAFTLEHFLSKPEEELFLNMENNEETRPVLGWIPRAGVTKPQTN
LLELKNSFSKTGAQKRFHKSILEDHKDLRDNEHSGMKHQFYGHNSYYFYN
NT seq 1773 nt   +upstreamnt  +downstreamnt
atggaagtcattcacggcaggccctactgttgcagggagcttgaaggagctgacatactg
tccaacaccttttactctaatgaattgcacaaccccctccagacggttactcgcccaact
gcctcagaggacaggtatcaggaattaagggagtcacttcaacaatgtaggcttccttgg
ggcgctgaaagagagtatggtgggataataccgatttcactccccgaggaccacaggcca
aagtatgagcctcctcgtgtcatgggcaaaggacatcagcattatggatttggtggagaa
acctggccaagaaagcttcctgttgaacaattttattatttgacccagaacaaaaaaagt
gatgtctatggaaatgattctttgatacccaagccgcctaattcaacagtaggagagatc
tgcttgccatatccaattgaacacccctaccacacacacatctgtcgcggcgccatgttc
cccaccttcacgtcacctgaggacctctacacgggcattaaagcccgcacccagcagccc
tttcctcccacggtgccaaccaaggcttatgattcaacagttttgaagacaagaggtaat
ccttatagatatgaactgattgatattcccatggattcaaagaagaaagcactgacttgg
ccaggtcaaggtgtatattatgattttcccagaggtgttgagaaaaataagccagtattc
tacccaaaacctcctaaaaccttcgctcctaacacttctttaaattcatgggaccctatt
tgctctgccaaagaagccaacatacaaagaaatcttgagaggtcccactggctcacttcg
tacactcatgattttacaggtctggggcccatggacccccttgaactggatgattaccat
gaaaagatggtagcagagttaacacgaaagataggatttgacccagagccgcaagaaaaa
ttccaccctgtcttcaaacctcccagaccgttggaaggacgaattgcccgattaattcag
aaccgacgttctctggaggctatagtccagcaaagaccacgttcctgtccagattgtact
cctagagttttgtgtaattttcatacctttgtacccagttctaaagaaatggtggcactt
agtgataacataccagccggtgtgacccataaaaaccaggatattgaagagaagatcata
gaagaacagagcttgctgtctacctatgaactcccatcttgttacccaacaaaagaccta
actagcatttatgacataaagccatttccaaaaatcacagatactaaaaagacagaagat
ttatactggagacagcagtcactaaaaacccaacccacaccttactgtaaaccagaccac
tggattcactatgaaaatcttaaatctcccctacgtgatcagtataatatgtgtccagac
cctgttagccttagtaaacctagtgttttacaaaataaacaagacacggaagctttcact
ttagaacattttttaagtaagccagaagaagagttgttcttgaatatggaaaacaatgaa
gaaacaagacctgttcttggttggattcctagagctggagtgaccaaacctcagaccaac
ctgctggagcttaagaactctttttcaaaaactggtgcacaaaagcgtttccataaatca
attctagaagaccataaagacctcagggataatgagcattcggggatgaagcaccaattc
tatggccataattcctattatttctataattga

DBGET integrated database retrieval system