KEGG   Homo sapiens (human): 1369Help
Entry
1369              CDS       T01001                                 

Gene name
CPN1, CPN, SCPN
Definition
(RefSeq) carboxypeptidase N subunit 1
  KO
K01292  carboxypeptidase N catalytic subunit [EC:3.4.17.3]
Organism
hsa  Homo sapiens (human)
Disease
H01136  Carboxypeptidase N deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    1369 (CPN1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.3  lysine carboxypeptidase
     1369 (CPN1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   1369 (CPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M14 CarboxypepD_reg CarbopepD_reg_2 DUF2817
Motif
Other DBs
NCBI-GeneID: 1369
NCBI-ProteinID: NP_001299
OMIM: 603103
HGNC: 2312
Ensembl: ENSG00000120054
Vega: OTTHUMG00000018896
Pharos: P15169(Tchem)
UniProt: P15169
Structure
PDB: 

Position
10q24.2
AA seq 458 aa AA seqDB search
MSDLLSVFLHLLLLFKLVAPVTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHL
YVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQD
TRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPN
HHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRT
ASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT
NCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVIS
VSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIP
QVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacctgctctcagtcttcctccacctcctccttctcttcaagttggttgccccg
gtgacctttcgccaccaccgctatgatgatcttgtgcggacgctgtacaaggtgcaaaac
gaatgccccggcatcacgcgggtctacagcattgggcgcagcgtggaggggagacacctc
tacgtgctggagttcagcgaccaccctggaatccacgagcccttggaaccagaggtcaag
tatgtggggaacatgcacggcaacgaagcgttgggccgcgagctgatgctgcagctgtcg
gagtttctgtgcgaggagttccggaacaggaaccagcgcatcgtccagctcatccaggac
acgcgcattcacatcctgccatccatgaaccccgacggctacgaggtggctgctgcccag
ggcccaaacaagcctgggtatctagttggcaggaacaatgcaaatggagtggacctgaac
cgcaacttccctgatctcaatacctatatctactataacgagaagtacggaggccccaac
caccacctgccccttccagacaactggaaaagtcaggtggaacccgagacccgggcggtg
atccggtggatgcactccttcaactttgttctttcagccaatctccacggaggggcggtg
gtggccaattacccgtatgacaagtcctttgagcaccgggtccgaggggtccgccgcacc
gccagcacccccacgcctgacgacaagctcttccagaagctggccaaggtctactcctat
gcacatggatggatgttccaaggttggaactgcggagattacttcccagatggcatcacc
aatggggcttcctggtattctctcagcaagggaatgcaagactttaattatctccatacc
aactgctttgagatcacgctggaactgagttgcgacaagtttccccccgaagaggagtta
cagcgggagtggctgggtaatcgggaagccctaatccagttcctggaacaggttcaccag
ggcatcaagggaatggtgcttgatgagaattacaataatctcgccaatgctgtcatttct
gtcagtgggattaaccatgatgtcacttcaggtgaccatggtgattacttccggctgctg
cttccaggtatctacactgttagtgccacagcacctgggtatgacccagagacagtaact
gtgaccgtgggtcctgcggaaccaacgttggttaacttccacctcaaaagaagcatccct
caagtaagccctgtgaggagagctcccagcagaaggcacggagtcagagccaaagtgcag
ccccaagccagaaagaaagaaatggagatgaggcagctgcagagaggccctgcctga

DBGET integrated database retrieval system