KEGG   Homo sapiens (human): 1371
Entry
1371              CDS       T01001                                 

Gene name
CPOX, COX, CPO, CPX, HARPO, HCP
Definition
(RefSeq) coproporphyrinogen oxidase
  KO
K00228  coproporphyrinogen III oxidase [EC:1.3.3.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00860  Porphyrin and chlorophyll metabolism
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Network
nt06011  Heme biosynthesis
  Element
N00601  Heme biosynthesis
N00602  FECH deficiency in heme biosynthesis
N00603  PPOX deficiency in heme biosynthesis
N00604  CPOX deficiency in heme biosynthesis
Disease
H00202  Hepatic porphyria
H01763  Porphyria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    1371 (CPOX)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.3  coproporphyrinogen oxidase
     1371 (CPOX)
SSDB
Motif
Pfam: Coprogen_oxidas
Other DBs
NCBI-GeneID: 1371
NCBI-ProteinID: NP_000088
OMIM: 612732
HGNC: 2321
Ensembl: ENSG00000080819
Vega: OTTHUMG00000160016
Pharos: P36551(Tbio)
UniProt: P36551
Structure
PDB: 
2AEX

Position
3q11.2
AA seq 454 aa
MALQLGRLSSGPCWLVARGGCGGPRAWSQCGGGGLRAWSQRSAAGRVCRPPGPAGTEQSR
GLGHGSTSRGGPWVGTGLAAALAGLVGLATAAFGHVQRAEMLPKTSGTRATSLGRPEEEE
DELAHRCSSFMAPPVTDLGELRRRPGDMKTKMELLILETQAQVCQALAQVDGGANFSVDR
WERKEGGGGISCVLQDGCVFEKAGVSISVVHGNLSEEAAKQMRSRGKVLKTKDGKLPFCA
MGVSSVIHPKNPHAPTIHFNYRYFEVEEADGNKQWWFGGGCDLTPTYLNQEDAVHFHRTL
KEACDQHGPDLYPKFKKWCDDYFFIAHRGERRGIGGIFFDDLDSPSKEEVFRFVQSCARA
VVPSYIPLVKKHCDDSFTPQEKLWQQLRRGRYVEFNLLYDRGTKFGLFTPGSRIESILMS
LPLTARWEYMHSPSENSKEAEILEVLRHPRDWVR
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggccttgcagctgggcaggctgagctcgggcccctgctggctcgtggcgcggggcggc
tgcggagggccccgcgcctggtcccagtgcggcggcggagggctccgagcctggtcccag
cgcagcgcagccggacgcgtctgccggccccctggcccggctggcacggagcagagccgc
gggctggggcacggctcgacgtcgagaggcggcccctgggtggggacagggctggccgcg
gcgctggcggggttggtggggctggccaccgccgccttcgggcatgtgcagcgggcggag
atgttgcctaagacctcggggacgcgggccacttcgctggggaggccggaggaggaggag
gatgagctggcccaccgctgcagcagcttcatggccccgcctgtgaccgacctgggcgag
ctgcgaaggaggccgggcgacatgaagaccaagatggagctgctgattctggagacccag
gcccaggtgtgccaggctctggcacaggtagacgggggcgccaacttttctgtggaccgg
tgggagaggaaggaaggaggtggcggcatcagctgtgtacttcaagatgggtgtgttttc
gaaaaggctggggtgagcatttctgttgttcatggaaatctttcagaggaagctgcaaaa
caaatgagaagcagaggaaaagttctgaagactaaagatggtaaattgccattttgtgct
atgggcgtgagctctgttatccaccccaagaatcctcatgctcctactatccatttcaac
tacagatactttgaagtagaagaagctgatggcaacaagcagtggtggtttggtggtgga
tgtgacctcactccaacatacttgaatcaagaagacgctgtccattttcacagaactctg
aaggaggcttgtgaccagcatggtccagatctctaccccaaatttaaaaaatggtgtgat
gattacttctttatagcccatcgtggagaacggcggggcattggtggtatcttttttgat
gatcttgactctccgtccaaggaggaggtgtttcgctttgtacagagctgtgccagggct
gtagttccttcttacattccccttgtgaaaaagcactgtgatgactcattcaccccccag
gagaagctgtggcagcagctcagaagaggacggtatgtagaatttaatctgctgtatgat
cggggcacaaagtttggcctcttcactccaggatccagaattgaaagtatcttgatgtct
ttacctctaactgcccgatgggagtacatgcattcaccctcagagaattccaaagaagct
gaaattctggaagttctacgccatccaagggactgggtgcgttga

DBGET integrated database retrieval system