KEGG   Homo sapiens (human): 137209Help
Entry
137209            CDS       T01001                                 

Gene name
ZNF572
Definition
(RefSeq) zinc finger protein 572
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 Zn-ribbon_8 zf-C2H2_6 zf-C2H2_jaz zf-C2H2_11 zf_UBZ zinc_ribbon_15 C1_4 zf-Di19
Motif
Other DBs
NCBI-GeneID: 137209
NCBI-ProteinID: NP_689625
HGNC: 26758
Ensembl: ENSG00000180938
Vega: OTTHUMG00000164988
Pharos: Q7Z3I7(Tdark)
UniProt: Q7Z3I7
Position
8q24.13
AA seq 529 aa AA seqDB search
MEQEKKLLVSDSNSFMERESLKSPFTGDTSMNNLETVHHNNSKADKLKEKPSEWSKRHRP
QHYKHEDAKEMPLTWVQDEIWCHDSYESDGKSENWGNFIAKEEEKPNHQEWDSGEHTNAC
VQQNSSFVDRPYKCSECWKSFSNSSHLRTHQRTHSGEKPYKCSECAKCFCNSSHLIQHLR
MHTGEKPYQCGECGKSFSNTSHLIIHERTHTGEKPYKCPECGKRFSSSSHLIQHHRSHTG
EKPYECSVCGKGFSHSYVLIEHQRTHTGEKPYKCPDCGKSFSQSSSLIRHQRTHTGEKPY
KCLECEKSFGCNSTLIKHQRIHTGEKPYQCPECGKNFSRSSNLITHQKMHTGEKSYESSE
YEESLGQNCNVIEECRIQLGEKPYRCCECGKSFGLSSHLIRHQRTHTGEKPYRCSECWKT
FSQSSTLVIHQRTHTGEKPYKCPDCGESFSQSFNLIRHRRTHIGEKPYKCTSCEKCFSRS
AYLSQHRKIHVEKPFESPDVGDFPHEWTWKNCSGEMPFISSFSVSNSSS
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagaaaaaaaactgttggtctcagattctaacagctttatggagagggagagt
ttgaaaagccctttcacaggagatacaagtatgaataatttggaaactgttcaccacaat
aattctaaggcagataaacttaaagagaaaccttcagaatggtctaaaagacatagacca
caacattataagcatgaggatgcaaaagaaatgccactgacatgggttcaagatgagatt
tggtgtcatgattcctatgagagtgatggcaagtcagagaattggggaaattttatagct
aaagaggaggaaaaacccaatcaccaggaatgggactcaggagaacataccaatgcctgt
gtccagcagaattcatcctttgtagacagaccctataaatgttccgaatgttggaaaagc
ttcagtaatagttctcatttgcgtactcaccagaggacccactcaggagaaaagccttat
aaatgctctgagtgtgcaaaatgtttttgtaacagttctcacctgattcagcatctaaga
atgcacacaggagagaagccctaccagtgtggtgaatgtgggaaaagcttcagcaatacc
tcccatcttattatccatgagagaactcacacgggagagaaaccctacaaatgtcccgag
tgtgggaagagattcagcagcagctctcaccttattcagcatcacagatcacatacaggt
gaaaaaccatatgaatgttctgtctgcggaaaaggcttcagtcacagctatgtcctaata
gaacatcagaggactcacactggagaaaaaccttataagtgccctgattgtgggaagagt
tttagtcagagttccagcctcattcgccaccagcggacacacacaggtgagaagccctac
aaatgtcttgagtgtgaaaaaagctttggttgtaattctactctaataaaacatcagaga
atacatacaggagaaaagccttatcaatgtccagaatgtgggaagaattttagtcgtagt
tcaaaccttattacacaccagaaaatgcacacaggagagaaatcctatgaaagttctgaa
tatgaggaaagtttgggtcagaactgcaatgtgatagaagaatgcagaatccagttagga
gagaaaccatatagatgttgtgaatgtgggaagagttttggccttagctcccatctcatt
agacatcagagaacacatacaggagaaaaaccttacagatgttctgagtgctggaaaact
ttcagtcagagttccaccctggtgattcaccaaaggacacatacaggagagaaaccttat
aaatgtcctgattgtggtgaaagcttcagtcagagctttaaccttatcaggcaccggagg
acccacataggggaaaaaccttacaaatgtaccagctgtgagaaatgcttcagcagaagt
gcctacctcagtcagcatcggaaaattcacgtagaaaagccttttgagtctcccgacgtt
ggggattttcctcatgaatggacttggaaaaactgttcaggggaaatgcccttcatctct
tcattttccgtctcaaattcatcttcctga

DBGET integrated database retrieval system