KEGG   Homo sapiens (human): 1375Help
Entry
1375              CDS       T01001                                 

Gene name
CPT1B, CPT1-M, CPT1M, CPTI, CPTI-M, M-CPT1, MCCPT1, MCPT1
Definition
(RefSeq) carnitine palmitoyltransferase 1B
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04152  AMPK signaling pathway
hsa04714  Thermogenesis
hsa04920  Adipocytokine signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
Network
nt06020  beta-Oxidation in mitochondria
  Element
N00765  beta-Oxidation, acyl-CoA synthesis
N00771  CPT2 deficiency in beta-oxidation
Drug target
Oxfenicine: D05292
Perhexiline (DG00334): D05442 D08340
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    1375 (CPT1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    1375 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    1375 (CPT1B)
   04920 Adipocytokine signaling pathway
    1375 (CPT1B)
   03320 PPAR signaling pathway
    1375 (CPT1B)
  09159 Environmental adaptation
   04714 Thermogenesis
    1375 (CPT1B)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    1375 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    1375 (CPT1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     1375 (CPT1B)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    1375 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N DUF3128
Motif
Other DBs
NCBI-GeneID: 1375
NCBI-ProteinID: NP_001138607
OMIM: 601987
HGNC: 2329
Ensembl: ENSG00000205560
Vega: OTTHUMG00000137390
Pharos: Q92523(Tchem)
UniProt: Q92523 A0A024R4W7 Q53FV7 A5PLL0
Position
22q13.33
AA seq 772 aa AA seqDB search
MAEAHQAVAFQFTVTPDGVDFRLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVIMATVGSSFCNVDISLGLVSCIQRCLPQGCGPYQTPQTRALLSMAIFSTGVWVTG
IFFFRQTLKLLLCYHGWMFEMHGKTSNLTRIWAMCIRLLSSRHPMLYSFQTSLPKLPVPR
VSATIQRYLESVRPLLDDEEYYRMELLAKEFQDKTAPRLQKYLVLKSWWASNYVSDWWEE
YIYLRGRSPLMVNSNYYVMDLVLIKNTDVQAARLGNIIHAMIMYRRKLDREEIKPVMALG
IVPMCSYQMERMFNTTRIPGKDTDVLQHLSDSRHVAVYHKGRFFKLWLYEGARLLKPQDL
EMQFQRILDDPSPPQPGEEKLAALTAGGRVEWAQARQAFFSSGKNKAALEAIERAAFFVA
LDEESYSYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGQLGLNAEHAWADAPI
IGHLWEFVLGTDSFHLGYTETGHCLGKPNPALAPPTRLQWDIPKQCQAVIESSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGKFCLTYEASMTRMFREG
RTETVRSCTSESTAFVQAMMEGSHTKADLRDLFQKAAKKHQNMYRLAMTGAGIDRHLFCL
YLVSKYLGVSSPFLAEVLSEPWRLSTSQIPQSQIRMFDPEQHPNHLGAGGGFGPVADDGY
GVSYMIAGENTIFFHISSKFSSSETNAQRFGNHIRKALLDIADLFQVPKAYS
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagctcaccaggccgtggccttccagttcacggtgaccccagacggggtcgac
ttccggctcagtcgggaggccctgaaacacgtctacctgtctgggatcaactcctggaag
aaacgcctgatccgcatcaagaatggcatcctcaggggcgtgtaccctggcagccccacc
agctggctggtcgtcatcatggcaacagtgggttcctccttctgcaacgtggacatctcc
ttggggctggtcagttgcatccagagatgcctccctcaggggtgtggcccctaccagacc
ccgcagacccgggcacttctcagcatggccatcttctccacgggcgtctgggtgacgggc
atcttcttcttccgccaaaccctgaagctgcttctctgctaccatgggtggatgtttgag
atgcatggcaagaccagcaacttgaccaggatctgggctatgtgtatccgccttctatcc
agccggcaccctatgctctacagcttccagacatctctgcccaagcttcctgtgcccagg
gtgtcagccacaattcagcggtacctagagtctgtgcgccccttgttggatgatgaggaa
tattaccgcatggagttgctggccaaagaattccaggacaagactgcccccaggctgcag
aaatacctggtgctcaagtcatggtgggcaagtaactatgtgagtgactggtgggaagag
tacatctaccttcgaggcaggagccctctcatggtgaacagcaactattatgtcatggac
cttgtgctcatcaagaatacagacgtgcaggcagcccgcctgggaaacatcatccacgcc
atgatcatgtatcgccgtaaactggaccgtgaagaaatcaagcctgtgatggcactgggc
atagtgcctatgtgctcctaccagatggagaggatgttcaacaccactcggatcccgggc
aaggacacagatgtgctacagcacctctcagacagccggcacgtggctgtctaccacaag
ggacgcttcttcaagctgtggctctatgagggcgcccgtctgctcaagcctcaggatctg
gagatgcagttccagaggatcctggacgacccctccccacctcagcctggggaggagaag
ctggcagccctcactgcaggaggaagggtggagtgggcgcaggcacgccaggccttcttt
agctctggaaagaataaggctgccttggaggccatcgagcgtgccgctttcttcgtggcc
ctggatgaggaatcctactcctatgaccccgaagatgaggccagcctcagcctctatggc
aaggccctgctacatggcaactgctacaacaggtggtttgacaaatccttcactctcatt
tccttcaagaatggccagttgggtctcaatgcagagcatgcgtgggcagatgctcccatc
attgggcacctctgggagtttgtcctgggcacagacagcttccacctgggctacacggag
accgggcactgcctgggcaaaccgaaccctgcgctcgcacctcctacacggctgcagtgg
gacattccaaaacagtgccaggcggtcatcgagagttcctaccaggtggccaaggcgttg
gcagacgacgtggagttgtactgcttccagttcctgccctttggcaaaggcctcatcaag
aagtgccggaccagccctgatgcctttgtgcagatcgcgctgcagctggctcacttccgg
gacaggggtaagttctgcctgacctatgaggcctcaatgaccagaatgttccgggaggga
cggactgagactgtgcgttcctgtaccagcgagtccacagcctttgtgcaggccatgatg
gaggggtcccacacaaaagcagacctgcgagatctcttccagaaggctgctaagaagcac
cagaatatgtaccgcctggccatgaccggggcagggatcgacaggcacctcttctgcctt
tacttggtctccaagtacctaggagtcagctctcctttccttgctgaggtgctctcggaa
ccctggcgtctctccaccagccagatcccccaatcccagatccgcatgttcgacccagag
cagcaccccaatcacctgggcgctggaggtggctttggccctgtagcagatgatggctat
ggagtttcctacatgattgcaggcgagaacacgatcttcttccacatctccagcaagttc
tcaagctcagagacgaacgcccagcgctttggaaaccacatccgcaaagccctgctggac
attgctgatcttttccaagttcccaaggcctacagctga

DBGET integrated database retrieval system