KEGG   Homo sapiens (human): 137695Help
Entry
137695            CDS       T01001                                 

Gene name
TMEM68
Definition
(RefSeq) transmembrane protein 68
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Acyltransferase DAGAT
Motif
Other DBs
NCBI-GeneID: 137695
NCBI-ProteinID: NP_001273586
HGNC: 26510
Ensembl: ENSG00000167904
Vega: OTTHUMG00000164293
Pharos: Q96MH6(Tdark)
UniProt: Q96MH6
Position
8q12.1
AA seq 324 aa AA seqDB search
MIDKNQTCGVGQDSVPYMICLIHILEEWFGVEQLEDYLNFANYLLWVFTPLILLILPYFT
IFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGARKTVATLWDGHAAVWHGYEVHGMEKIPE
DGPALIIFYHGAIPIDFYYFMAKIFIHKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPR
EKCVEILRSGHLLAISPGGVREALISDETYNIVWGHRRGFAQVAIDAKVPIIPMFTQNIR
EGFRSLGGTRLFRWLYEKFRYPFAPMYGGFPVKLRTYLGDPIPYDPQITAEELAEKTKNA
VQALIDKHQRIPGNIMSALLERFH
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgatagacaaaaatcaaacctgtggtgtaggacaggattctgtgccctatatgatttgt
ctgattcacatactcgaagaatggtttggtgtggagcagttggaggactatttgaatttt
gcaaactatctcttgtgggtttttacaccactaatacttttaatacttccttactttact
atctttcttctctaccttactattattttcttacacatttataagagaaagaatgtattg
aaagaagcctactctcataatttatgggatggtgcaaggaaaacagtggcaactctgtgg
gatggacatgcagccgtttggcatggttatgaagttcatggaatggaaaaaataccagaa
gatggaccagcacttataattttttatcatggagctattcctatagatttttactatttc
atggctaaaatatttatacacaaaggcagaacttgccgagtagtagctgatcactttgtc
tttaaaattccagggtttagtttattactggatgtgttttgtgctctacatggaccaaga
gaaaaatgtgttgaaattctgaggagtggccacttgttagctatctcaccaggtggagtt
cgagaagccctaattagtgatgaaacttataacatcgtatggggtcatcgcagaggcttt
gctcaggttgcaattgatgcaaaagtgcccattattcctatgtttacacaaaatattcga
gaaggatttagatcacttggaggaacaaggttatttaggtggctttatgaaaaattccgc
tatccatttgctccaatgtatggaggttttccagtgaagttacggacctatttaggcgac
cccattccgtatgacccacagataacagcggaagaattagctgaaaagacgaagaatgct
gttcaagctttgattgataagcaccaaagaataccaggaaacattatgagtgctttgtta
gaacgttttcattga

DBGET integrated database retrieval system