KEGG   Homo sapiens (human): 137797Help
Entry
137797            CDS       T01001                                 

Gene name
LYPD2, LYPDC2, UNQ430
Definition
(RefSeq) LY6/PLAUR domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Toxin_TOLIP UPAR_LY6
Motif
Other DBs
NCBI-GeneID: 137797
NCBI-ProteinID: NP_991108
HGNC: 25215
Ensembl: ENSG00000197353
Vega: OTTHUMG00000164686
Pharos: Q6UXB3(Tdark)
UniProt: Q6UXB3 F1T0L0
Position
8q24.3
AA seq 125 aa AA seqDB search
MRGTRLALLALVLAACGELAPALRCYVCPEPTGVSDCVTIATCTTNETMCKTTLYSREIV
YPFQGDSTVTKSCASKCKPSDVDGIGQTLPVSCCNTELCNVDGAPALNSLHCGALTLLPL
LSLRL
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcgggggacgcggctggcgctcctggcgctggtgctggctgcctgcggagagctggcg
ccggccctgcgctgctacgtctgtccggagcccacaggagtgtcggactgtgtcaccatc
gccacctgcaccaccaacgaaaccatgtgcaagaccacactctactcccgggagatagtg
taccccttccagggggactccacggtgaccaagtcctgtgccagcaagtgtaagccctcg
gatgtggatggcatcggccagaccctgcccgtgtcctgctgcaatactgagctgtgcaat
gtagacggggcgcccgctctgaacagcctccactgcggggccctcacgctcctcccactc
ttgagcctccgactgtag

DBGET integrated database retrieval system