KEGG   Homo sapiens (human): 137872
Entry
137872            CDS       T01001                                 
Symbol
ADHFE1, ADH8, HMFT2263, HOT
Name
(RefSeq) alcohol dehydrogenase iron containing 1
  KO
K11173  hydroxyacid-oxoacid transhydrogenase [EC:1.1.99.24]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    137872 (ADHFE1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.99  With unknown physiological acceptors
    1.1.99.24  hydroxyacid-oxoacid transhydrogenase
     137872 (ADHFE1)
SSDB
Motif
Pfam: Fe-ADH Fe-ADH_2 Peripla_BP_6
Other DBs
NCBI-GeneID: 137872
NCBI-ProteinID: NP_653251
OMIM: 611083
HGNC: 16354
Ensembl: ENSG00000147576
UniProt: Q8IWW8
Position
8:66432504..66468907
AA seq 467 aa
MAAAARARVAYLLRQLQRAACQCPTHSHTYSQAPGLSPSGKTTDYAFEMAVSNIRYGAAV
TKEVGMDLKNMGAKNVCLMTDKNLSKLPPVQVAMDSLVKNGIPFTVYDNVRVEPTDSSFM
EAIEFAQKGAFDAYVAVGGGSTMDTCKAANLYASSPHSDFLDYVSAPIGKGKPVSVPLKP
LIAVPTTSGTGSETTGVAIFDYEHLKVKIGITSRAIKPTLGLIDPLHTLHMPARVVANSG
FDVLCHALESYTTLPYHLRSPCPSNPITRPAYQGSNPISDIWAIHALRIVAKYLKRAVRN
PDDLEARSHMHLASAFAGIGFGNAGVHLCHGMSYPISGLVKMYKAKDYNVDHPLVPHGLS
VVLTSPAVFTFTAQMFPERHLEMAEILGADTRTARIQDAGLVLADTLRKFLFDLDVDDGL
AAVGYSKADIPALVKGTLPQERVTKLAPCPQSEEDLAALFEASMKLY
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggccgctgccgcccgagcccgggtcgcgtacttgctgaggcaactgcaacgcgcagcg
tgccagtgcccaactcattctcatacttactcccaagcccctggactttcaccttctggg
aaaacaacagattatgcctttgagatggctgtttcaaatattagatatggagcagcagtt
acaaaggaagtaggaatggacctaaaaaacatgggtgctaaaaatgtgtgcttgatgaca
gacaagaacctctccaagctccctcctgtgcaagtagctatggattccctagtgaagaat
ggcatcccctttacggtttatgataatgtgagagtggaaccaacggattcaagcttcatg
gaagctattgagtttgcccaaaagggagcttttgatgcctatgttgctgtcggtggtggc
tctaccatggacacctgtaaggctgctaatctgtatgcatccagccctcattctgatttc
ctagattatgtcagtgcccccattggcaagggaaagcctgtgtctgtgcctcttaagcct
ctgattgcagtgccaactacctcaggaaccgggagtgaaactactggggttgccattttt
gactatgaacacttgaaagtaaaaattggcatcacttcgagagccatcaaacccacactg
ggactgattgatcctctgcacaccctccacatgcctgcccgagtggtcgccaacagtggc
tttgatgtgctttgccatgccctggagtcatacaccaccctgccctaccacctgcggagc
ccctgcccttcaaatcccatcacacggcctgcgtaccagggcagcaacccaatcagtgac
atttgggctatccacgcgctgcggatcgtggctaagtatctgaagagggctgtcagaaat
cccgatgatcttgaagcaaggtctcatatgcacttggcaagtgcttttgctggcatcggc
tttggaaatgctggtgttcatctgtgccatggaatgtcttacccaatttcaggtttagtg
aagatgtataaagcaaaggattacaatgtggatcacccactggtgccccatggcctttct
gtggtgctcacgtccccagcggtgttcactttcacggcccagatgtttccagagcgacac
ctggagatggcagaaatactgggagccgacacccgcactgccaggatccaagatgcaggg
ctggtgttggcagacacgctccggaaattcttattcgatctggatgttgatgatggccta
gcagctgttggttactccaaagctgatatccccgcactagtgaaaggaacgctgccccag
gaaagggtcaccaagcttgcaccctgtccccagtcagaagaggatctggctgctctgttt
gaagcttcaatgaaactgtattaa

DBGET integrated database retrieval system