KEGG   Homo sapiens (human): 137970Help
Entry
137970            CDS       T01001                                 

Gene name
UNC5D, PRO34692, Unc5h4
Definition
(RefSeq) unc-5 netrin receptor D
  KO
K07521  netrin receptor unc-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    137970 (UNC5D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPA ZU5 Death I-set Ig_3 TSP_1 ig Ig_2 V-set Ig_6
Motif
Other DBs
NCBI-GeneID: 137970
NCBI-ProteinID: NP_543148
OMIM: 616466
HGNC: 18634
Ensembl: ENSG00000156687
Vega: OTTHUMG00000157145
Pharos: Q6UXZ4(Tbio)
UniProt: Q6UXZ4
Position
8p12
AA seq 953 aa AA seqDB search
MGRAAATAGGGGGARRWLPWLGLCFWAAGTAAARGTDNGEALPESIPSAPGTLPHFIEEP
DDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEETLDESSGLKVREVFINVTR
QQVEDFHGPEDYWCQCVAWSHLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHC
RPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKR
RSLSATVVVYVNGGWSSWTEWSACNVRCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKIT
CTSLCPVDGSWEVWSEWSVCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCI
LDKKPLHEIKPQSIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSQSDYGVDVIDSSAL
TGGFQTFNFKTVRQGNSLLLNSAMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNPLSD
IKVKVQSSFMVSLGVSERAEYHGKNHSRTFPHGNNHSFSTMHPRNKMPYIQNLSSLPTRT
ELRTTGVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQSDGSEVLLS
PEVTCGPPDMIVTTPFALTIPHCADVSSEHWNIHLKKRTQQGKWEEVMSVEDESTSCYCL
LDPFACHVLLDSFGTYALTGEPITDCAVKQLKVAVFGCMSCNSLDYNLRVYCVDNTPCAF
QEVVSDERHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVWC
SNRQPLHCAFSLERYTPTTTQLSCKICIRQLKGHEQILQVQTSILESERETITFFAQEDS
TFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAV
ILNLWEARHQHDGDLDSLACALEEIGRTHTKLSNISESQLDEADFNYSRQNGL
NT seq 2862 nt NT seq  +upstreamnt  +downstreamnt
atggggagagcggcggccaccgcaggcggcggcggaggggcgcgccgctggctcccgtgg
ctggggctgtgcttctgggcggcagggaccgcggctgcccgaggaactgacaatggcgaa
gcccttcccgaatccatcccatcagctcctgggacactgcctcatttcatagaggagcca
gatgatgcttatattatcaagagcaaccctattgcactcaggtgcaaagcgaggccagcc
atgcagatattcttcaaatgcaacggcgagtgggtccatcagaacgagcacgtctctgaa
gagactctggacgagagctcaggtttgaaggtccgcgaagtgttcatcaatgttactagg
caacaggtggaggacttccatgggcccgaggactattggtgccagtgtgtggcgtggagc
cacctgggtacctccaagagcaggaaggcctctgtgcgcatagcctatttacggaaaaac
tttgaacaagacccacaaggaagggaagttcccattgaaggcatgattgtactgcactgc
cgcccaccagagggagtccctgctgccgaggtggaatggctgaaaaatgaagagcccatt
gactctgaacaagacgagaacattgacaccagggctgaccataacctgatcatcaggcag
gcacggctctcggactcaggaaattacacctgcatggcagccaacatcgtggctaagagg
agaagcctgtcggccactgttgtggtctacgtgaatggaggctggtcttcctggacagag
tggtcagcctgcaatgttcgctgtggtagaggatggcagaaacgttcccggacctgcacc
aacccagctcctctcaatggtggggccttttgtgagggaatgtcagtgcagaaaataacc
tgcacttctctttgtcctgtggatgggagctgggaagtgtggagcgaatggtccgtctgc
agtccagagtgtgaacatttgcggatccgggagtgcacagcaccacccccgagaaatggg
ggcaaattctgtgaaggtctaagccaggaatctgaaaactgcacagatggtctttgcatc
ctagataaaaaacctcttcatgaaataaaaccccaaagcattgagaatgccagcgacatt
gctttgtactcgggcttgggtgctgccgtcgtggccgttgcagtcctggtcattggtgtc
accctttacagacggagccagagtgactatggcgtggacgtcattgactcttctgcattg
acaggtggcttccagaccttcaacttcaaaacagtccgtcaaggtaactccctgctcctg
aattctgccatgcagccagatctgacagtgagccggacatacagcggacccatctgtctg
caggaccctctggacaaggagctcatgacagagtcctcactctttaaccctttgtcggac
atcaaagtgaaagtccagagctcgttcatggtttccctgggagtgtctgagagagctgag
taccacggcaagaatcattccaggacttttccccatggaaacaaccacagctttagtaca
atgcatcccagaaataaaatgccctacatccaaaatctgtcatcactccccacaaggaca
gaactgaggacaactggtgtctttggccatttaggggggcgcttagtaatgccaaataca
ggggtgagcttactcataccacacggtgccatcccagaggagaattcttgggagatttat
atgtccatcaaccaaggtgaacccagcctccagtcagatggctctgaggtgctcctgagt
cctgaagtcacctgtggtcctccagacatgatcgtcaccactccctttgcattgaccatc
ccgcactgtgcagatgtcagttctgagcattggaatatccatttaaagaagaggacacag
cagggcaaatgggaggaagtgatgtcagtggaagatgaatctacatcctgttactgcctt
ttggacccctttgcgtgtcatgtgctcctggacagctttgggacctatgcgctcactgga
gagccaatcacagactgtgccgtgaagcaactgaaggtggcggtttttggctgcatgtcc
tgtaactccctggattacaacttgagagtttactgtgtggacaataccccttgtgcattt
caggaagtggtttcagatgaaaggcatcaaggtggacagctcctggaagaaccaaaattg
ctgcatttcaaagggaatacctttagtcttcagatttctgtccttgatattcccccattc
ctctggagaattaaaccattcactgcctgccaggaagtcccgttctcccgcgtgtggtgc
agtaaccggcagcccctgcactgtgccttctccctggagcgttatacgcccactaccacc
cagctgtcctgcaaaatctgcattcggcagctcaaaggccatgaacagatcctccaagtg
cagacatcaatcctagagagtgaacgagaaaccatcactttcttcgcacaagaggacagc
actttccctgcacagactggccccaaagccttcaaaattccctactccatcagacagcgg
atttgtgctacatttgatacccccaatgccaaaggcaaggactggcagatgttagcacag
aaaaacagcatcaacaggaatttatcttatttcgctacacaaagtagcccatctgctgtc
attttgaacctgtgggaagctcgtcatcagcatgatggtgatcttgactccctggcctgt
gcccttgaagagattgggaggacacacacgaaactctcaaacatttcagaatcccagctt
gatgaagccgacttcaactacagcaggcaaaatggactctag

DBGET integrated database retrieval system