KEGG   Homo sapiens (human): 137970
Entry
137970            CDS       T01001                                 

Symbol
UNC5D, PRO34692, Unc5h4
Name
(RefSeq) unc-5 netrin receptor D
  KO
K07521  netrin receptor unc-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    137970 (UNC5D)
SSDB
Motif
Pfam: UPA ZU5 Death I-set Ig_3 TSP_1 ig TSP1_spondin Ig_2 TSP1_ADAMTS V-set Ig_6
Other DBs
NCBI-GeneID: 137970
NCBI-ProteinID: NP_543148
OMIM: 616466
HGNC: 18634
Ensembl: ENSG00000156687
Vega: OTTHUMG00000157145
Pharos: Q6UXZ4(Tbio)
UniProt: Q6UXZ4
Position
8p12
AA seq 953 aa
MGRAAATAGGGGGARRWLPWLGLCFWAAGTAAARGTDNGEALPESIPSAPGTLPHFIEEP
DDAYIIKSNPIALRCKARPAMQIFFKCNGEWVHQNEHVSEETLDESSGLKVREVFINVTR
QQVEDFHGPEDYWCQCVAWSHLGTSKSRKASVRIAYLRKNFEQDPQGREVPIEGMIVLHC
RPPEGVPAAEVEWLKNEEPIDSEQDENIDTRADHNLIIRQARLSDSGNYTCMAANIVAKR
RSLSATVVVYVNGGWSSWTEWSACNVRCGRGWQKRSRTCTNPAPLNGGAFCEGMSVQKIT
CTSLCPVDGSWEVWSEWSVCSPECEHLRIRECTAPPPRNGGKFCEGLSQESENCTDGLCI
LDKKPLHEIKPQSIENASDIALYSGLGAAVVAVAVLVIGVTLYRRSQSDYGVDVIDSSAL
TGGFQTFNFKTVRQGNSLLLNSAMQPDLTVSRTYSGPICLQDPLDKELMTESSLFNPLSD
IKVKVQSSFMVSLGVSERAEYHGKNHSRTFPHGNNHSFSTMHPRNKMPYIQNLSSLPTRT
ELRTTGVFGHLGGRLVMPNTGVSLLIPHGAIPEENSWEIYMSINQGEPSLQSDGSEVLLS
PEVTCGPPDMIVTTPFALTIPHCADVSSEHWNIHLKKRTQQGKWEEVMSVEDESTSCYCL
LDPFACHVLLDSFGTYALTGEPITDCAVKQLKVAVFGCMSCNSLDYNLRVYCVDNTPCAF
QEVVSDERHQGGQLLEEPKLLHFKGNTFSLQISVLDIPPFLWRIKPFTACQEVPFSRVWC
SNRQPLHCAFSLERYTPTTTQLSCKICIRQLKGHEQILQVQTSILESERETITFFAQEDS
TFPAQTGPKAFKIPYSIRQRICATFDTPNAKGKDWQMLAQKNSINRNLSYFATQSSPSAV
ILNLWEARHQHDGDLDSLACALEEIGRTHTKLSNISESQLDEADFNYSRQNGL
NT seq 2862 nt   +upstreamnt  +downstreamnt
atggggagagcggcggccaccgcaggcggcggcggaggggcgcgccgctggctcccgtgg
ctggggctgtgcttctgggcggcagggaccgcggctgcccgaggaactgacaatggcgaa
gcccttcccgaatccatcccatcagctcctgggacactgcctcatttcatagaggagcca
gatgatgcttatattatcaagagcaaccctattgcactcaggtgcaaagcgaggccagcc
atgcagatattcttcaaatgcaacggcgagtgggtccatcagaacgagcacgtctctgaa
gagactctggacgagagctcaggtttgaaggtccgcgaagtgttcatcaatgttactagg
caacaggtggaggacttccatgggcccgaggactattggtgccagtgtgtggcgtggagc
cacctgggtacctccaagagcaggaaggcctctgtgcgcatagcctatttacggaaaaac
tttgaacaagacccacaaggaagggaagttcccattgaaggcatgattgtactgcactgc
cgcccaccagagggagtccctgctgccgaggtggaatggctgaaaaatgaagagcccatt
gactctgaacaagacgagaacattgacaccagggctgaccataacctgatcatcaggcag
gcacggctctcggactcaggaaattacacctgcatggcagccaacatcgtggctaagagg
agaagcctgtcggccactgttgtggtctacgtgaatggaggctggtcttcctggacagag
tggtcagcctgcaatgttcgctgtggtagaggatggcagaaacgttcccggacctgcacc
aacccagctcctctcaatggtggggccttttgtgagggaatgtcagtgcagaaaataacc
tgcacttctctttgtcctgtggatgggagctgggaagtgtggagcgaatggtccgtctgc
agtccagagtgtgaacatttgcggatccgggagtgcacagcaccacccccgagaaatggg
ggcaaattctgtgaaggtctaagccaggaatctgaaaactgcacagatggtctttgcatc
ctagataaaaaacctcttcatgaaataaaaccccaaagcattgagaatgccagcgacatt
gctttgtactcgggcttgggtgctgccgtcgtggccgttgcagtcctggtcattggtgtc
accctttacagacggagccagagtgactatggcgtggacgtcattgactcttctgcattg
acaggtggcttccagaccttcaacttcaaaacagtccgtcaaggtaactccctgctcctg
aattctgccatgcagccagatctgacagtgagccggacatacagcggacccatctgtctg
caggaccctctggacaaggagctcatgacagagtcctcactctttaaccctttgtcggac
atcaaagtgaaagtccagagctcgttcatggtttccctgggagtgtctgagagagctgag
taccacggcaagaatcattccaggacttttccccatggaaacaaccacagctttagtaca
atgcatcccagaaataaaatgccctacatccaaaatctgtcatcactccccacaaggaca
gaactgaggacaactggtgtctttggccatttaggggggcgcttagtaatgccaaataca
ggggtgagcttactcataccacacggtgccatcccagaggagaattcttgggagatttat
atgtccatcaaccaaggtgaacccagcctccagtcagatggctctgaggtgctcctgagt
cctgaagtcacctgtggtcctccagacatgatcgtcaccactccctttgcattgaccatc
ccgcactgtgcagatgtcagttctgagcattggaatatccatttaaagaagaggacacag
cagggcaaatgggaggaagtgatgtcagtggaagatgaatctacatcctgttactgcctt
ttggacccctttgcgtgtcatgtgctcctggacagctttgggacctatgcgctcactgga
gagccaatcacagactgtgccgtgaagcaactgaaggtggcggtttttggctgcatgtcc
tgtaactccctggattacaacttgagagtttactgtgtggacaataccccttgtgcattt
caggaagtggtttcagatgaaaggcatcaaggtggacagctcctggaagaaccaaaattg
ctgcatttcaaagggaatacctttagtcttcagatttctgtccttgatattcccccattc
ctctggagaattaaaccattcactgcctgccaggaagtcccgttctcccgcgtgtggtgc
agtaaccggcagcccctgcactgtgccttctccctggagcgttatacgcccactaccacc
cagctgtcctgcaaaatctgcattcggcagctcaaaggccatgaacagatcctccaagtg
cagacatcaatcctagagagtgaacgagaaaccatcactttcttcgcacaagaggacagc
actttccctgcacagactggccccaaagccttcaaaattccctactccatcagacagcgg
atttgtgctacatttgatacccccaatgccaaaggcaaggactggcagatgttagcacag
aaaaacagcatcaacaggaatttatcttatttcgctacacaaagtagcccatctgctgtc
attttgaacctgtgggaagctcgtcatcagcatgatggtgatcttgactccctggcctgt
gcccttgaagagattgggaggacacacacgaaactctcaaacatttcagaatcccagctt
gatgaagccgacttcaactacagcaggcaaaatggactctag

KEGG   Homo sapiens (human): 219699
Entry
219699            CDS       T01001                                 

Symbol
UNC5B, UNC5H2, p53RDL1
Name
(RefSeq) unc-5 netrin receptor B
  KO
K07521  netrin receptor unc-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    219699 (UNC5B)
SSDB
Motif
Pfam: UPA ZU5 Death I-set Ig_3 TSP_1 TSP1_spondin Ig_2 ig TSP1_ADAMTS Chromo_2 TSP1_CCN
Other DBs
NCBI-GeneID: 219699
NCBI-ProteinID: NP_734465
OMIM: 607870
HGNC: 12568
Ensembl: ENSG00000107731
Vega: OTTHUMG00000018422
Pharos: Q8IZJ1(Tbio)
UniProt: Q8IZJ1
Position
10q22.1
AA seq 945 aa
MGARSGARGALLLALLLCWDPRLSQAGTDSGSEVLPDSFPSAPAEPLPYFLQEPQDAYIV
KNKPVELRCRAFPATQIYFKCNGEWVSQNDHVTQEGLDEATGLRVREVQIEVSRQQVEEL
FGLEDYWCQCVAWSSAGTTKSRRAYVRIAYLRKNFDQEPLGKEVPLDHEVLLQCRPPEGV
PVAEVEWLKNEDVIDPTQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTAT
VIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQAFQKTACTTICP
VDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCMQNKKTL
SDPNSHLLEASGDAALYAGLVVAIFVVVAILMAVGVVVYRRNCRDFDTDITDSSAALTGG
FHPVNFKTARPSNPQLLHPSVPPDLTASAGIYRGPVYALQDSTDKIPMTNSPLLDPLPSL
KVKVYSSSTTGSGPGLADGADLLGVLPPGTYPSDFARDTHFLHLRSASLGSQQLLGLPRD
PGSSVSGTFGCLGGRLSIPGTGVSLLVPNGAIPQGKFYEMYLLINKAESTLPLSEGTQTV
LSPSVTCGPTGLLLCRPVILTMPHCAEVSARDWIFQLKTQAHQGHWEEVVTLDEETLNTP
CYCQLEPRACHILLDQLGTYVFTGESYSRSAVKRLQLAVFAPALCTSLEYSLRVYCLEDT
PVALKEVLELERTLGGYLVEEPKPLMFKDSYHNLRLSLHDLPHAHWRSKLLAKYQEIPFY
HIWSGSQKALHCTFTLERHSLASTELTCKICVRQVEGEGQIFQLHTTLAETPAGSLDTLC
SAPGSTVTTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRMLAQKLSMDRYLNYFATKA
SPTGVILDLWEALQQDDGDLNSLASALEEMGKSEMLVAVATDGDC
NT seq 2838 nt   +upstreamnt  +downstreamnt
atgggggcccggagcggagctcggggcgcgctgctgctggcactgctgctctgctgggac
ccgaggctgagccaagcaggcactgattctggcagcgaggtgctccctgactccttcccg
tcagcgccagcagagccgctgccctacttcctgcaggagccacaggacgcctacattgtg
aagaacaagcctgtggagctccgctgccgcgccttccccgccacacagatctacttcaag
tgcaacggcgagtgggtcagccagaacgaccacgtcacacaggaaggcctggatgaggcc
accggcctgcgggtgcgcgaggtgcagatcgaggtgtcgcggcagcaggtggaggagctc
tttgggctggaggattactggtgccagtgcgtggcctggagctccgcgggcaccaccaag
agtcgccgagcctacgtccgcatcgcctacctgcgcaagaacttcgatcaggagcctctg
ggcaaggaggtgcccctggaccatgaggttctcctgcagtgccgcccgccggagggggtg
cctgtggccgaggtggaatggctcaagaatgaggatgtcatcgaccccacccaggacacc
aacttcctgctcaccatcgaccacaacctcatcatccgccaggcccgcctgtcggacact
gccaactatacctgcgtggccaagaacatcgtggccaaacgccggagcaccactgccacc
gtcatcgtctacgtgaatggcggctggtccagctgggcagagtggtcaccctgctccaac
cgctgtggccgaggctggcagaagcgcacccggacctgcaccaaccccgctccactcaac
ggaggggccttctgcgagggccaggcattccagaagaccgcctgcaccaccatctgccca
gtcgatggggcgtggacggagtggagcaagtggtcagcctgcagcactgagtgtgcccac
tggcgtagccgcgagtgcatggcgcccccaccccagaacggaggccgtgactgcagcggg
acgctgctcgactctaagaactgcacagatgggctgtgcatgcaaaataagaaaactcta
agcgaccccaacagccacctgctggaggcctcaggggatgcggcgctgtatgcggggctc
gtggtggccatcttcgtggtcgtggcaatcctcatggcggtgggggtggtggtgtaccgc
cgcaactgccgtgacttcgacacagacatcactgactcatctgctgccctgactggtggt
ttccaccccgtcaactttaagacggcaaggcccagcaacccgcagctcctacacccctct
gtgcctcctgacctgacagccagcgccggcatctaccgcggacccgtgtatgccctgcag
gactccaccgacaaaatccccatgaccaactctcctctgctggaccccttacccagcctt
aaggtcaaggtctacagctccagcaccacgggctctgggccaggcctggcagatggggct
gacctgctgggggtcttgccgcctggcacataccctagcgatttcgcccgggacacccac
ttcctgcacctgcgcagcgccagcctcggttcccagcagctcttgggcctgccccgagac
ccagggagcagcgtcagcggcacctttggctgcctgggtgggaggctcagcatccccggc
acaggggtcagcttgctggtgcccaatggagccattccccagggcaagttctacgagatg
tatctactcatcaacaaggcagaaagtaccctcccgctttcagaagggacccagacagta
ttgagcccctcggtgacctgtggacccacaggcctcctgctgtgccgccccgtcatcctc
accatgccccactgtgccgaagtcagtgcccgtgactggatctttcagctcaagacccag
gcccaccagggccactgggaggaggtggtgaccctggatgaggagaccctgaacacaccc
tgctactgccagctggagcccagggcctgtcacatcctgctggaccagctgggcacctac
gtgttcacgggcgagtcctattcccgctcagcagtcaagcggctccagctggccgtcttc
gcccccgccctctgcacctccctggagtacagcctccgggtctactgcctggaggacacg
cctgtagcactgaaggaggtgctggagctggagcggactctgggcggatacttggtggag
gagccgaaaccgctaatgttcaaggacagttaccacaacctgcgcctctccctccatgac
ctcccccatgcccattggaggagcaagctgctggccaaataccaggagatccccttctat
cacatttggagtggcagccagaaggccctccactgcactttcaccctggagaggcacagc
ttggcctccacagagctcacctgcaagatctgcgtgcggcaagtggaaggggagggccag
atattccagctgcataccactctggcagagacacctgctggctccctggacactctctgc
tctgcccctggcagcactgtcaccacccagctgggaccttatgccttcaagatcccactg
tccatccgccagaagatatgcaacagcctagatgcccccaactcacggggcaatgactgg
cggatgttagcacagaagctctctatggaccggtacctgaattactttgccaccaaagcg
agccccacgggtgtgatcctggacctctgggaagctctgcagcaggacgatggggacctc
aacagcctggcgagtgccttggaggagatgggcaagagtgagatgctggtggctgtggcc
accgacggggactgctga

KEGG   Homo sapiens (human): 8633
Entry
8633              CDS       T01001                                 

Symbol
UNC5C, UNC5H3
Name
(RefSeq) unc-5 netrin receptor C
  KO
K07521  netrin receptor unc-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    8633 (UNC5C)
SSDB
Motif
Pfam: UPA ZU5 Death Ig_3 I-set TSP_1 TSP1_spondin Ig_2 ig TSP1_ADAMTS AtuA
Other DBs
NCBI-GeneID: 8633
NCBI-ProteinID: NP_003719
OMIM: 603610
HGNC: 12569
Ensembl: ENSG00000182168
Vega: OTTHUMG00000130989
Pharos: O95185(Tbio)
UniProt: O95185 A8K385
Position
4q22.3
AA seq 931 aa
MRKGLRATAARCGLGLGYLLQMLVLPALALLSASGTGSAAQDDDFFHELPETFPSDPPEP
LPHFLIEPEEAYIVKNKPVNLYCKASPATQIYFKCNSEWVHQKDHIVDERVDETSGLIVR
EVSIEISRQQVEELFGPEDYWCQCVAWSSAGTTKSRKAYVRIAYLRKTFEQEPLGKEVSL
EQEVLLQCRPPEGIPVAEVEWLKNEDIIDPVEDRNFYITIDHNLIIKQARLSDTANYTCV
AKNIVAKRKSTTATVIVYVNGGWSTWTEWSVCNSRCGRGYQKRTRTCTNPAPLNGGAFCE
GQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSK
NCTDGLCMQTAPDSDDVALYVGIVIAVIVCLAISVVVALFVYRKNHRDFESDIIDSSALN
GGFQPVNIKAARQDLLAVPPDLTSAAAMYRGPVYALHDVSDKIPMTNSPILDPLPNLKIK
VYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALSLKNQSLARQTDPSCTAFGSFNSLG
GHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMRPPMDDSQTLLTPVVSCGPPGAL
LTRPVVLTMHHCADPNTEDWKILLKNQAAQGQWEDVVVVGEENFTTPCYIQLDAEACHIL
TENLSTYALVGHSTTKAAAKRLKLAIFGPLCCSSLEYSIRVYCLDDTQDALKEILHLERQ
MGGQLLEEPKALHFKGSTHNLRLSIHDIAHSLWKSKLLAKYQEIPFYHVWSGSQRNLHCT
FTLERFSLNTVELVCKLCVRQVEGEGQIFQLNCTVSEEPTGIDLPLLDPANTITTVTGPS
AFSIPLPIRQKLCSSLDAPQTRGHDWRMLAHKLNLDRYLNYFATKSSPTGVILDLWEAQN
FPDGNLSMLAAVLEEMGRHETVVSLAAEGQY
NT seq 2796 nt   +upstreamnt  +downstreamnt
atgaggaaaggtctgcgggcgacagcggcccgctgcggactgggactgggatacttgctg
caaatgctcgtgctacctgccctggccctgctcagcgccagcggcactggctccgccgcc
caagatgatgacttttttcatgaactcccagaaacttttccttctgatccacctgagcct
ctgccacatttccttattgagcctgaagaagcttatattgtgaagaataagcccgtgaac
ctgtactgtaaagcaagccctgccacccagatctatttcaagtgtaatagtgaatgggtt
catcagaaggaccacatagtagatgaaagagtagatgaaacttccggtctcattgtccgg
gaagtgagcattgagatttcgcgccagcaagtggaagaactctttggacctgaagattac
tggtgccagtgtgtggcctggagctccgcgggtaccacaaagagccggaaggcgtatgtg
cgcattgcatatctacggaagacatttgagcaggaacccctaggaaaggaagtgtctttg
gaacaggaagtcttactccagtgtcgaccacctgaagggatcccagtggctgaggtggaa
tggttgaaaaatgaagacataattgatcccgttgaagatcggaatttttatattactatt
gatcacaacctcatcataaagcaggcccgactctctgatactgcaaattacacctgtgtt
gccaaaaacattgttgccaagaggaaaagtacaactgccactgtcatagtctatgtcaac
ggtggctggtccacctggacggagtggtctgtgtgtaacagccgctgtggacgagggtat
cagaaacgtacaaggacttgtaccaacccggcaccactcaatgggggtgccttctgtgaa
gggcagagtgtgcagaaaatagcctgtactacgttatgcccagtggatggcaggtggacg
ccatggagcaagtggtctacttgtggaactgagtgcacccactggcgcaggagggagtgc
acggcgccagcccccaagaatggaggcaaggactgcgacggcctcgtcttgcaatccaag
aactgcactgatgggctttgcatgcagactgctcctgattcagatgatgttgctctctat
gttgggattgtgatagcagtgatcgtttgcctggcgatctctgtagttgtggccttgttt
gtgtatcggaagaatcatcgtgactttgagtcagatattattgactcttcggcactcaat
gggggctttcagcctgtgaacatcaaggcagcaagacaagatctgctggctgtaccccca
gacctcacgtcagctgcagccatgtacagaggacctgtctatgccctgcatgacgtctca
gacaaaatcccaatgaccaactctccaattctggatccactgcccaacctgaaaatcaaa
gtgtacaacacctcaggtgctgtcaccccccaagatgacctctctgagtttacgtccaag
ctgtcccctcagatgacccagtcgttgttggagaatgaagccctcagcctgaagaaccag
agtctagcaaggcagactgatccatcctgtaccgcatttggcagcttcaactcgctggga
ggtcaccttattgttcccaattcaggagtcagcttgctgattcccgctggggccattccc
caagggagagtctacgaaatgtatgtgactgtacacaggaaagaaactatgaggccaccc
atggatgactctcagacacttttgacccctgtggtgagctgtgggcccccaggagctctg
ctcacccgcccagtcgtcctcactatgcatcactgcgcagaccccaataccgaggactgg
aaaatactgctcaagaaccaggcagcacagggacagtgggaggatgtggtggtggtcggg
gaggaaaacttcaccaccccctgctacattcagctggatgcagaggcctgccacatcctc
acagagaacctcagcacctacgccctggtaggacattccaccaccaaagcggctgcgaag
cgcctcaagctggccatctttgggcccctgtgctgctcctcgctggagtacagcatccga
gtctactgtctggatgacacccaggatgccctgaaggaaattttacatcttgagagacag
atgggaggacagctcctagaagaacctaaggctcttcattttaaaggcagcacccacaac
ctgcgcctgtcaattcacgatatcgcccattccctctggaagagcaaattgctggctaaa
tatcaggaaattccattttaccatgtttggagtggatctcaaagaaacctgcactgcacc
ttcactctggaaagatttagcctgaacacagtggagctggtttgcaaactctgtgtgcgg
caggtggaaggagaagggcagatcttccagctcaactgcaccgtgtcagaggaacctact
ggcatcgatttgccgctgctggatcctgcgaacaccatcaccacggtcacggggcccagt
gctttcagcatccctctccctatccggcagaagctctgtagcagcctggatgccccccag
acgagaggccatgactggaggatgctggcccataagctgaacctggacaggtacttgaat
tactttgccaccaaatccagcccaactggcgtaatcctggatctttgggaagcacagaac
ttcccagatggaaacctgagcatgctggcagctgtcttggaagaaatgggaagacatgaa
acggtggtgtccttagcagcagaagggcagtattaa

KEGG   Homo sapiens (human): 90249
Entry
90249             CDS       T01001                                 

Symbol
UNC5A, UNC5H1
Name
(RefSeq) unc-5 netrin receptor A
  KO
K07521  netrin receptor unc-5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    90249 (UNC5A)
SSDB
Motif
Pfam: UPA ZU5 Death Ig_3 I-set Ig_2 ig TSP_1 TSP1_spondin
Other DBs
NCBI-GeneID: 90249
NCBI-ProteinID: NP_588610
OMIM: 607869
HGNC: 12567
Ensembl: ENSG00000113763
Vega: OTTHUMG00000163225
Pharos: Q6ZN44(Tbio)
UniProt: Q6ZN44
Structure
PDB: 
4V2A

Position
5q35.2
AA seq 842 aa
MAVRPGLWPALLGIVLAAWLRGSGAQQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKP
VLLVCKAVPATQIFFKCNGEWVRQVDHVIERSTDGSSGLPTMEVRINVSRQQVEKVFGLE
EYWCQCVAWSSSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAE
VEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVY
VDGSWSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECQGTDLDTRNCTSDLCVHTASGP
EDVALYVGLIAVAVCLVLLLLVLILVYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADN
PHLLTIQPDLSTTTTTYQGSLCPRQDGPSPKFQLTNGHLLSPLGGGRHTLHHSSPTSEAE
EFVSRLSTQNYFRSLPRGTSNMTYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYL
TLHKPEDVRLPLAGCQTLLSPIVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLKKQSC
EGSWEDVLHLGEEAPSHLYYCQLEASACYVFTEQLGRFALVGEALSVAAAKRLKLLLFAP
VACTSLEYNIRVYCLHDTHDALKEVVQLEKQLGGQLIQEPRVLHFKDSYHNLRLSIHDVP
SSLWKSKLLVSYQEIPFYHIWNGTQRYLHCTFTLERVSPSTSDLACKLWVWQVEGDGQSF
SINFNITKDTRFAELLALESEAGVPALVGPSAFKIPFLIRQKIISSLDPPCRRGADWRTL
AQKLHLDSHLSFFASKPSPTAMILNLWEARHFPNGNLSQLAAAVAGLGQPDAGLFTVSEA
EC
NT seq 2529 nt   +upstreamnt  +downstreamnt
atggccgtccggcccggcctgtggccagcgctcctgggcatagtcctcgccgcttggctc
cgcggctcgggtgcccagcagagtgccaccgtggccaacccagtgcctggtgccaacccg
gacctgcttccccacttcctggtggagcccgaggatgtgtacatcgtcaagaacaagcca
gtgctgcttgtgtgcaaggccgtgcccgccacgcagatcttcttcaagtgcaacggggag
tgggtgcgccaggtggaccacgtgatcgagcgcagcacagacgggagcagtgggctgccc
accatggaggtccgcattaatgtctcaaggcagcaggtcgagaaggtgttcgggctggag
gaatactggtgccagtgcgtggcatggagctcctcgggcaccaccaagagtcagaaggcc
tacatccgcatagcctatttgcgcaagaacttcgagcaggagccgctggccaaggaggtg
tccctggagcagggcatcgtgctgccctgccgtccaccggagggcatccctccagccgag
gtggagtggctccggaacgaggacctggtggacccgtccctggaccccaatgtatacatc
acgcgggagcacagcctggtggtgcgacaggcccgccttgctgacacggccaactacacc
tgcgtggccaagaacatcgtggcacgtcgccgcagcgcctccgctgctgtcatcgtctac
gtggacggcagctggagcccgtggagcaagtggtcggcctgtgggctggactgcacccac
tggcggagccgtgagtgctctgacccagcaccccgcaacggaggggaggagtgccagggc
actgacctggacacccgcaactgtaccagtgacctctgtgtacacactgcttctggccct
gaggacgtggccctctatgtgggcctcatcgccgtggccgtctgcctggtcctgctgctg
cttgtcctcatcctcgtttattgccggaagaaggaggggctggactcagatgtggctgac
tcgtccattctcacctcaggcttccagcccgtcagcatcaagcccagcaaagcagacaac
ccccatctgctcaccatccagccggacctcagcaccaccaccaccacctaccagggcagt
ctctgtccccggcaggatgggcccagccccaagttccagctcaccaatgggcacctgctc
agccccctgggtggcggccgccacacactgcaccacagctctcccacctctgaggccgag
gagttcgtctcccgcctctccacccagaactacttccgctccctgccccgaggcaccagc
aacatgacctatgggaccttcaacttcctcgggggccggctgatgatccctaatacagga
atcagcctcctcatccccccagatgccataccccgagggaagatctatgagatctacctc
acgctgcacaagccggaagacgtgaggttgcccctagctggctgtcagaccctgctgagt
cccatcgttagctgtggaccccctggcgtcctgctcacccggccagtcatcctggctatg
gaccactgtggggagcccagccctgacagctggagcctgcgcctcaaaaagcagtcgtgc
gagggcagctgggaggatgtgctgcacctgggcgaggaggcgccctcccacctctactac
tgccagctggaggccagtgcctgctacgtcttcaccgagcagctgggccgctttgccctg
gtgggagaggccctcagcgtggctgccgccaagcgcctcaagctgcttctgtttgcgccg
gtggcctgcacctccctcgagtacaacatccgggtctactgcctgcatgacacccacgat
gcactcaaggaggtggtgcagctggagaagcagctggggggacagctgatccaggagcca
cgggtcctgcacttcaaggacagttaccacaacctgcgcctatccatccacgatgtgccc
agctccctgtggaagagtaagctccttgtcagctaccaggagatccccttttatcacatc
tggaatggcacgcagcggtacttgcactgcaccttcaccctggagcgtgtcagccccagc
actagtgacctggcctgcaagctgtgggtgtggcaggtggagggcgacgggcagagcttc
agcatcaacttcaacatcaccaaggacacaaggtttgctgagctgctggctctggagagt
gaagcgggggtcccagccctggtgggccccagtgccttcaagatccccttcctcattcgg
cagaagataatttccagcctggacccaccctgtaggcggggtgccgactggcggactctg
gcccagaaactccacctggacagccatctcagcttctttgcctccaagcccagccccaca
gccatgatcctcaacctgtgggaggcgcggcacttccccaacggcaacctcagccagctg
gctgcagcagtggctggactgggccagccagacgctggcctcttcacagtgtcggaggct
gagtgctga

DBGET integrated database retrieval system