KEGG   Homo sapiens (human): 138162
Entry
138162            CDS       T01001                                 
Symbol
PIERCE1, C9orf116, RbEST47
Name
(RefSeq) piercer of microtubule wall 1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4490
Other DBs
NCBI-GeneID: 138162
NCBI-ProteinID: NP_001041730
OMIM: 614502
HGNC: 28435
Ensembl: ENSG00000160345
Pharos: Q5BN46(Tdark)
UniProt: Q5BN46
Position
9:complement(135495181..135499869)
AA seq 136 aa
MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSN
QAYGSRAPTVHEMPKVFYPNSNKFSQQLAAGGMFRNNTLNVYLEKSIVTGPDNCITSCDR
LNFHPSYNINRPSICD
NT seq 411 nt   +upstreamnt  +downstreamnt
atggctgaggaatgccccagagcgtgcgcggagcctgtggcgcccaaggccacggccccg
ccggagaggaccagcgactactaccgcgtgagcgcggacctgccgggcaggttcaacaac
ccggggtggttccggggctacaggacccagaaggctgtctccgtgtacaggaccagtaac
caggcttacgggagcagagcccccaccgtgcacgagatgcctaaagtattttatccaaat
tcgaataaattttcccaacaacttgcagcgggtggaatgttccggaacaatactctcaat
gtttacctggagaaaagcatcgtgactggccccgataactgcatcacctcctgtgaccgg
ctcaacttccaccccagttacaacatcaacaggccatccatctgcgattga

DBGET integrated database retrieval system