KEGG   Homo sapiens (human): 1386Help
Entry
1386              CDS       T01001                                 

Gene name
ATF2, CRE-BP1, CREB-2, CREB2, HB16, TREB7
Definition
(RefSeq) activating transcription factor 2
  KO
K04450  cyclic AMP-dependent transcription factor ATF-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04211  Longevity regulating pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04668  TNF signaling pathway
hsa04714  Thermogenesis
hsa04728  Dopaminergic synapse
hsa04911  Insulin secretion
hsa04915  Estrogen signaling pathway
hsa04918  Thyroid hormone synthesis
hsa04922  Glucagon signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00444  TNF-p38 signaling pathway
 » show all
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    1386 (ATF2)
   04668 TNF signaling pathway
    1386 (ATF2)
   04022 cGMP - PKG signaling pathway
    1386 (ATF2)
   04151 PI3K-Akt signaling pathway
    1386 (ATF2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    1386 (ATF2)
   04922 Glucagon signaling pathway
    1386 (ATF2)
   04915 Estrogen signaling pathway
    1386 (ATF2)
   04926 Relaxin signaling pathway
    1386 (ATF2)
   04918 Thyroid hormone synthesis
    1386 (ATF2)
   04928 Parathyroid hormone synthesis, secretion and action
    1386 (ATF2)
   04925 Aldosterone synthesis and secretion
    1386 (ATF2)
   04927 Cortisol synthesis and secretion
    1386 (ATF2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    1386 (ATF2)
  09156 Nervous system
   04728 Dopaminergic synapse
    1386 (ATF2)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    1386 (ATF2)
  09159 Environmental adaptation
   04714 Thermogenesis
    1386 (ATF2)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    1386 (ATF2)
  09164 Substance dependence
   05030 Cocaine addiction
    1386 (ATF2)
   05031 Amphetamine addiction
    1386 (ATF2)
   05034 Alcoholism
    1386 (ATF2)
  09166 Endocrine and metabolic diseases
   04934 Cushing syndrome
    1386 (ATF2)
  09167 Infectious diseases
   05166 HTLV-I infection
    1386 (ATF2)
   05164 Influenza A
    1386 (ATF2)
   05161 Hepatitis B
    1386 (ATF2)
   05163 Human cytomegalovirus infection
    1386 (ATF2)
   05169 Epstein-Barr virus infection
    1386 (ATF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1386 (ATF2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, CRE-BP/ATF
    1386 (ATF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf zf-C2H2 Herpes_UL16
Motif
Other DBs
NCBI-GeneID: 1386
NCBI-ProteinID: NP_001243019
OMIM: 123811
HGNC: 784
Ensembl: ENSG00000115966
Vega: OTTHUMG00000132424
Pharos: P15336(Tbio)
UniProt: P15336
Structure
PDB: 

Position
2q31.1
AA seq 505 aa AA seqDB search
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARN
DSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIR
SKIEEPSVVETTHQDSPLPHPESTTSDEKEVPLAQTAQPTSAIVRPASLQVPNVLLTSSD
SSVIIQQAVPSPTSSTVITQAPSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNV
HVPAAVPLVRPVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANEDPDEKRRKFLE
RNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLLLAHKDCPV
TAMQKKSGYHTADKDDSSEDISVPSSPHTEAIQHSSVSTSNGVSSTSKAEAVATSVLTQM
ADQSTEPALSQIVMAPSSQSQPSGS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaagttacatgtgaattctgccaggcaatacaaggacctgtggaatatgagt
gatgacaaaccctttctatgtactgcgcctggatgtggccagcgttttaccaacgaggat
catttggctgtccataaacataaacatgagatgacactgaaatttggtccagcacgtaat
gacagtgtcattgtggctgatcagaccccaacaccaacaagattcttgaaaaactgtgaa
gaagtgggtttgtttaatgagttggcgagtccatttgagaatgaattcaagaaagcttca
gaagatgacattaaaaaaatgcctctagatttatcccctcttgcaacacctatcataaga
agcaaaattgaggagccttctgttgtagaaacaactcaccaggatagtcctttacctcac
ccagagtctactaccagtgatgagaaggaagtaccattggcacaaactgcacagcccaca
tcagctattgttcgtccagcatcattacaggttcccaatgtgctgcttacaagttctgac
tcaagtgtaattattcagcaggcagtaccttcaccaacctcaagtactgtaatcacccag
gcaccatcctctaacaggccaattgtccctgtaccaggcccatttcctcttctgttacat
cttcctaatggacaaaccatgcctgttgctattcctgcatcaattacaagttctaatgtg
catgttccagctgcagtcccactcgttcgaccagtcaccatggtgcctagtgttccagga
atcccaggtccttcctctccccaaccagtacagtcagaagcaaaaatgagattaaaagct
gctttgacccagcaacatcctccagttaccaatggtgatactgtcaaaggtcatggtagc
ggattggttaggactcagtcagaggaatctcgaccgcagtcattacaacagccagccaca
tccactacagaaactccggcttctccagctcacacaactccacagacccaaagtacaagt
ggtcgtcggagaagagcagctaacgaagatcctgatgaaaaaaggagaaagtttttagag
cgaaatagagcagcagcttcaagatgccgacaaaaaaggaaagtctgggttcagtcttta
gagaagaaagctgaagacttgagttcattaaatggtcagctgcagagtgaagtcaccctg
ctgagaaatgaagtggcacagctgaaacagcttcttctggctcataaagattgccctgta
accgccatgcagaagaaatctggctatcatactgctgataaagatgatagttcagaagac
atttcagtgccgagtagtccacatacagaagctatacagcatagttcggtcagcacatcc
aatggagtcagttcaacctccaaggcagaagctgtagccacttcagtcctcacccagatg
gcggaccagagtacagagcctgctctttcacagatcgttatggctccttcctcccagtca
cagccctcaggaagttga

DBGET integrated database retrieval system