KEGG   Homo sapiens (human): 138715Help
Entry
138715            CDS       T01001                                 

Gene name
ARID3C
Definition
(RefSeq) AT-rich interaction domain 3C
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: ARID
Motif
Other DBs
NCBI-GeneID: 138715
NCBI-ProteinID: NP_001017363
HGNC: 21209
Ensembl: ENSG00000205143
Vega: OTTHUMG00000000445
Pharos: A6NKF2(Tdark)
UniProt: A6NKF2
Position
9p13.3
AA seq 412 aa AA seqDB search
MEALQKQQAARLAQGVGPLAPACPLLPPQPPLPDHRTLQAPEGALGNVGAEEEEDAEEDE
EKREEAGAEEEAAEESRPGAQGPSSPSSQPPGLHPHEWTYEEQFKQLYELDADPKRKEFL
DDLFSFMQKRGTPVNRVPIMAKQVLDLYALFRLVTAKGGLVEVINRKVWREVTRGLSLPT
TITSAAFTLRTQYMKYLYPYECETRALSSPGELQAAIDSNRREGRRQAYTATPLFGLAGP
PPRGAQDPALGPGPAPPATQSSPGPAQGSTSGLPAHACAQLSPSPIKKEESGIPNPCLAL
PVGLALGPTREKLAPEEPPEKRAVLMGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLA
GSGISSINMALEINGVVYTGVLFARRQPVPASQGPTNPAPPPSTGPPSSILP
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggaggccctgcagaagcagcaggcagctcggctggcccagggggtggggccattggcc
cctgcatgcccgctgctgccaccgcagcctcccctgcctgaccaccggaccctacaggcc
cctgagggggccttggggaatgttggggctgaggaagaggaagatgctgaagaagatgag
gagaagcgggaggaagccggggcagaggaggaggcagctgaggagagccgtccaggggcc
cagggccccagctcgccttctagccagccccctggactccatccccacgagtggacctac
gaggaacaattcaagcagctgtatgagctcgatgcagaccccaagaggaaggaatttctg
gatgacctgtttagcttcatgcaaaagagggggacgccagtgaaccgcgtgcccatcatg
gcgaagcaggtgctcgacctgtacgctctgtttcgcctggtgaccgccaagggcggcctg
gtggaagtcatcaaccgcaaagtgtggcgggaagtcacgcgcggcctcagcctacccacc
accatcacctcggccgccttcactctacgcacccagtacatgaagtacctgtacccgtac
gagtgcgagactcgagcgctcagctccccaggggagctccaggccgccatagacagcaat
cggcgcgagggccgtcgccaggcttacaccgctactccgctcttcggcttggcagggccg
ccccctcggggcgctcaggacccagccttgggtcccggccccgcccctccggcgacccag
tccagccctggcccagcccagggttccacctccggcctgccagcgcatgcatgcgctcag
ctgagtccaagccctattaagaaagaggagagtggaattccaaacccttgtctggcactg
cctgtgggcctggcactgggacctacacgggagaaattggcaccagaggagcccccagag
aagagagctgtgctgatggggcctatggacccacctcgaccttgcatgccccccagtttc
ctgccccgtggcaaggttcccctgagggaagagcggctggatgggcctcttaatctggca
ggcagtggcatcagcagtatcaacatggccctagagatcaacggggtggtctacactggt
gtcctctttgcccgccgccagcctgtgccagcttcccagggtccaaccaaccctgcaccc
ccaccctccacagggcccccttccagcatcttgccctga

DBGET integrated database retrieval system