KEGG   Homo sapiens (human): 1388
Entry
1388              CDS       T01001                                 

Symbol
ATF6B, CREB-RP, CREBL1, G13
Name
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04151  PI3K-Akt signaling pathway
hsa04211  Longevity regulating pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04668  TNF signaling pathway
hsa04728  Dopaminergic synapse
hsa04911  Insulin secretion
hsa04915  Estrogen signaling pathway
hsa04918  Thyroid hormone synthesis
hsa04925  Aldosterone synthesis and secretion
hsa04926  Relaxin signaling pathway
hsa04927  Cortisol synthesis and secretion
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04935  Growth hormone synthesis, secretion and action
hsa05020  Prion disease
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
hsa05207  Chemical carcinogenesis - receptor activation
Network
nt06123  TNF signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06140  Transcription (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06210  ERK signaling
nt06234  cAMP signaling
nt06263  Hepatocellular carcinoma
nt06310  CRH-ACTH-cortisol signaling
nt06316  Angiotensin-aldosterone signaling
nt06322  TRH-TSH-TH signaling
nt06324  GHRH-GH-IGF signaling
nt06360  Cushing syndrome
nt06415  PI3K signaling
nt06440  Transcription
nt06461  Huntington disease
nt06465  Prion disease
  Element
N00297  ACTH-cortisol signaling pathway
N00298  CYP11B1-CYP11B2 fusion to ACTH-cortisol signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
N00320  Mutation-activated PRKACA to ACTH-cortisol signaling pathway
N00321  Mutation-activated GNAS to ACTH-cortisol signaling pathway
N00322  Mutation-inactivated PRKAR1A to ACTH-cortisol signaling pathway
N00323  Mutation-inactivated PDE11A/PDE8B to ACTH-cortisol signaling pathway
N00324  CRHR-PKA-ACTH signaling pathway
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00326  Mutation-activated GNAS to CRHR-PKA-ACTH signaling pathway
N00327  Mutation-inactivated PRKAR1A to CRHR-PKA-ACTH signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00410  DRD1-GNAS-AC-PKA signaling pathway
N00411  HCMV UL33 to GNAS-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00444  TNF-p38 signaling pathway
N00544  HBV HBx to CREB-mediated transcription
N00782  TSH-TG signaling pathway
N00783  Mutation-inactivated TSH to TSH-TG signaling pathway
N00784  Mutation-inactivated TSHR to TSH-TG signaling pathway
N00797  Mutation-activated TSHR to TSH-TG signaling pathway
N00910  GHRHR-PKA-GH signaling pathway
N00912  Mutation-activated GNAS to GHRHR-PKA-GH signaling pathway
N00981  Mutation-caused aberrant Htt to CREB-mediated transcription
N01204  PRNP-PI3K-NOX2 signaling pathway
N01343  ACH-CHRN-RAS-ERK signaling pathway
N01351  E2-ER-RAS-ERK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1388 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    1388 (ATF6B)
   04022 cGMP-PKG signaling pathway
    1388 (ATF6B)
   04151 PI3K-Akt signaling pathway
    1388 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    1388 (ATF6B)
   04915 Estrogen signaling pathway
    1388 (ATF6B)
   04926 Relaxin signaling pathway
    1388 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    1388 (ATF6B)
   04918 Thyroid hormone synthesis
    1388 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    1388 (ATF6B)
   04925 Aldosterone synthesis and secretion
    1388 (ATF6B)
   04927 Cortisol synthesis and secretion
    1388 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    1388 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    1388 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    1388 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05207 Chemical carcinogenesis - receptor activation
    1388 (ATF6B)
   05203 Viral carcinogenesis
    1388 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    1388 (ATF6B)
   05161 Hepatitis B
    1388 (ATF6B)
   05163 Human cytomegalovirus infection
    1388 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    1388 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    1388 (ATF6B)
   05031 Amphetamine addiction
    1388 (ATF6B)
   05034 Alcoholism
    1388 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    1388 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1388 (ATF6B)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    1388 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 1388
NCBI-ProteinID: NP_004372
OMIM: 600984
HGNC: 2349
Ensembl: ENSG00000213676
Vega: OTTHUMG00000031296
Pharos: Q99941(Tbio)
UniProt: Q99941 Q6AZW6
Position
6p21.32
AA seq 703 aa
MAELMLLSEIADPTRFFTDNLLSPEDWGLQNSTLYSGLDEVAEEQTQLFRCPEQDVPFDG
SSLDVGMDVSPSEPPWELLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPSSEALGVGE
VLHVKTESLAPPLCLLGDDPTSSFETVQINVIPTSDDSSDVQTKIEPVSPCSSVNSEASL
LSADSSSQAFIGEEVLEVKTESLSPSGCLLWDVPAPSLGAVQISMGPSLDGSSGKALPTR
KPPLQPKPVVLTTVPMPSRAVPPSTTVLLQSLVQPPPVSPVVLIQGAIRVQPEGPAPSLP
RPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPP
SAPISPRMNKGEPQPRRHLLGFSEQEPVQGVEPLQGSSQGPKEPQPSPTDQPSFSNLTAF
PGGAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKS
QPRKKSPPVKAVPIQPPGPPERDSVGQLQLYRHPDRSQPAFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQPSPTPGNATGGPLPVSAASQAHQASHQPLYLNHP
NT seq 2112 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctgctcagcgagattgctgacccgacgcgtttcttcaccgacaac
ctgcttagcccggaggactggggtctgcagaacagcaccttgtattctggcctagatgaa
gtggccgaggagcagacgcagctcttccgttgcccggagcaggatgtcccgtttgacggc
agctccctggacgtggggatggatgtcagcccctctgagcccccatgggaactcctgccg
atcttcccagatcttcaggtgaagtctgagccatcttccccctgctcttcctcctccctc
agctccgagtcatcgcgtctctccacagagccatccagcgaggctcttggggtaggggag
gtgctccatgtgaagacagagtccttggcacccccactgtgtctcctgggagatgaccca
acatcctcatttgaaaccgtccagatcaacgttatccccacctctgatgattcctcagat
gtccagaccaagatagaacctgtctctccatgttcttccgtcaactctgaggcctccctg
ctctcagccgactcctccagccaggcttttataggagaggaggtcctggaagtgaagaca
gagtccctgtccccttcaggatgcctcctgtgggatgtcccagccccctcacttggagct
gtccagatcagcatgggcccatcccttgatggctcctcaggcaaagccctgcccacccgg
aagccgccactgcagcccaaacctgtagtgctaaccactgtcccaatgccatccagagct
gtgcctcccagcaccacagtccttctgcagtccctcgtccagccacccccagtgtcccca
gttgtcctcatccagggtgctattcgagtccagcctgaagggccggctccctctctacca
cggcctgagaggaagagcatcgttcccgctcctatgcctggaaactcctgcccgcctgaa
gtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaaccgggagtcagcctgc
cagtcccggagaaagaagaaagagtatctgcagggactggaggctcggctgcaagcagta
ctggctgacaaccagcagctccgccgagagaatgctgccctccggcggcggctggaggcc
ctgctggctgaaaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcatc
atggtcttccttctcttcattgccttcaactttggacctgtcagcatcagtgagcctcct
tcagctcccatctctcctcggatgaacaagggggagcctcaaccccggagacacttgctg
gggttctcagagcaagagccagttcagggagttgaacctctccaggggtcctcccagggc
cctaaggagccccagcccagccccacagaccagcccagtttcagcaacctgacagccttc
cctgggggcgccaaggagctactactaagagacctagaccagctcttcctctcctctgat
tgccggcacttcaaccgcactgagtccctgaggcttgctgacgagttgagtggctgggtc
cagcgccaccagagaggccggaggaagatccctcagagggcccaggagagacagaagtct
cagccacggaagaagtcacctccagttaaggcagtccccatccaaccccctggaccccca
gaaagggattctgtgggccagctgcaactatatcgccacccagaccgttcgcagccagca
ttcttggatgcaattgaccgacgggaagacacattttatgttgtctctttccgaagggac
cacctgctgctcccagccatcagccacaacaagacctcccggcccaagatgtccctggtg
atgcctgccatggcccccaatgagaccctgtcaggccgtggggccccgggggactatgag
gagatgatgcagatcgagtgtgaggtcatggacaccagggtgattcacatcaagacctcc
acagtgcccccctcgctccgaaaacagccatccccaaccccaggcaatgccacaggtggc
cccttgccagtctctgcagccagccaggcccaccaggcctcccaccagcccctctacctc
aatcatccctga

KEGG   Homo sapiens (human): 22926
Entry
22926             CDS       T01001                                 

Symbol
ATF6, ACHM7, ATF6A
Name
(RefSeq) activating transcription factor 6
  KO
K09054  cyclic AMP-dependent transcription factor ATF-6 alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05417  Lipid and atherosclerosis
Network
nt06412  Unfolded protein response (UPR) signaling
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N01015  ATF6-mediated transcription
N01016  Mutation-caused aberrant PSEN1 to ATF6-mediated transcription
N01033  Mutation-caused aberrant SNCA to ATF6-mediated transcription
N01147  Mutation-caused aberrant SOD1 to ATF6-mediated transcription
N01150  Mutation-inactivated VAPB to ATF6-mediated transcription
Disease
H00971  Achromatopsia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    22926 (ATF6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    22926 (ATF6)
   05012 Parkinson disease
    22926 (ATF6)
   05014 Amyotrophic lateral sclerosis
    22926 (ATF6)
   05022 Pathways of neurodegeneration - multiple diseases
    22926 (ATF6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    22926 (ATF6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    22926 (ATF6)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    22926 (ATF6)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin Methyltrans_RNA Docking
Other DBs
NCBI-GeneID: 22926
NCBI-ProteinID: NP_031374
OMIM: 605537
HGNC: 791
Ensembl: ENSG00000118217
Vega: OTTHUMG00000023961
Pharos: P18850(Tbio)
UniProt: P18850 A8K383
Position
1q23.3
AA seq 670 aa
MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNL
DFDLDLMPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEE
LDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQ
PKPLLLPAAPKTQTNSSVPAKTIIIQTVPTLMPLAKQQPIISLQPAPTKGQTVLLSQPTV
VQLQAPGVLPSAQPVLAVAGGVTQLPNHVVNVVPAPSANSPVNGKLSVTKPVLQSTMRNV
GSDIAVLRRQQRMIKNRESACQSRKKKKEYMLGLEARLKAALSENEQLKKENGTLKRQLD
EVVSENQRLKVPSPKRRVVCVMIVLAFIILNYGPMSMLEQDSRRMNPSVSPANQRRHLLG
FSAKEAQDTSDGIIQKNSYRYDHSVSNDKALMVLTEEPLLYIPPPPCQPLINTTESLRLN
HELRGWVHRHEVERTKSRRMTNNQQKTRILQGALEQGSNSQLMAVQYTETTSSISRNSGS
ELQVYYASPRSYQDFFEAIRRRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAINI
NENVINGQDYEVMMQIDCQVMDTRILHIKSSSVPPYLRDQQRNQTNTFFGSPPAATEATH
VVSTIPESLQ
NT seq 2013 nt   +upstreamnt  +downstreamnt
atgggggagccggctggggttgccggcaccatggagtcaccttttagcccgggactcttt
cacaggctggatgaagattgggattctgctctctttgctgaactcggttatttcacagac
actgatgagctgcaattggaagcagcaaatgagacgtatgaaaacaattttgataatctt
gattttgatttggatttgatgccttgggagtcagacatttgggacatcaacaaccaaatc
tgtacagttaaagatattaaggcagaacctcagccactttctccagcctcctcaagttat
tcagtctcgtctcctcggtcagtggactcttattcttcaactcagcatgttcctgaggag
ttggatttgtcttctagttctcagatgtctcccctttccttatatggtgaaaactctaat
agtctctcttcagcggagccactgaaggaagataagcctgtcactggtcctaggaacaag
actgaaaatggactgactccaaagaaaaaaattcaggtgaattcaaaaccttcaattcag
cccaagcctttattgcttccagcagcacccaagactcaaacaaactccagtgttccagca
aaaaccatcattattcagacagtaccaacgcttatgccattggcaaagcagcaaccaatt
atcagtttacaacctgcacccactaaaggccagacggttttgctgtctcagcctactgtg
gtacaacttcaagcacctggagttctgccctctgctcagccagtccttgctgttgctggg
ggagtcacacagctccctaatcacgtggtgaatgtggtaccagccccttcagcgaatagc
ccagtgaatggaaaactttccgtgactaaacctgtcctacaaagtaccatgagaaatgtc
ggttcagatattgctgtgctaaggagacagcaacgtatgataaaaaatcgagaatccgct
tgtcagtctcgcaagaagaagaaagaatatatgctagggttagaggcgagattaaaggct
gccctctcagaaaacgagcaactgaagaaagaaaatggaacactgaagcggcagctggat
gaagttgtgtcagagaaccagaggcttaaagtccctagtccaaagcgaagagttgtctgt
gtgatgatagtattggcatttataatactgaactatggacctatgagcatgttggaacag
gattccaggagaatgaaccctagtgtgagccctgcaaatcaaaggaggcaccttctagga
ttttctgctaaagaggcacaggacacatcagatggtattatccagaaaaacagctacaga
tatgatcattctgtttcaaatgacaaagccctgatggtgctaactgaagaaccattgctt
tacattcctccacctccttgtcagcccctaattaacacaacagagtctctcaggttaaat
catgaacttcgaggatgggttcatagacatgaagtagaaaggaccaagtcaagaagaatg
acaaataatcaacagaaaacccgtattcttcagggtgctctggaacagggctcaaattct
cagctgatggctgttcaatacacagaaaccactagtagtatcagcaggaactcagggagt
gagctacaagtgtattatgcttcacccagaagttatcaagacttttttgaagccatccgc
agaaggggagacacattttatgttgtgtcatttcgaagggatcacctgctgttaccagct
accacccataacaagaccacaagaccaaaaatgtcaattgtgttaccagcaataaacata
aatgagaatgtgatcaatgggcaggactacgaagtgatgatgcagattgactgtcaggtg
atggacaccaggatcctccatatcaaaagttcgtcagttcctccttacctccgagatcag
cagaggaatcaaaccaacaccttctttggctcccctcccgcagccacagaggcaacccac
gttgtcagcaccatccctgagtcattacaatag

DBGET integrated database retrieval system