KEGG   Homo sapiens (human): 138881Help
Entry
138881            CDS       T01001                                 

Gene name
OR1L8, OR9-24
Definition
(RefSeq) olfactory receptor family 1 subfamily L member 8
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    138881 (OR1L8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    138881 (OR1L8)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    138881 (OR1L8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 138881
NCBI-ProteinID: NP_001004454
HGNC: 15110
Ensembl: ENSG00000171496
Vega: OTTHUMG00000020609
Pharos: Q8NGR8(Tdark)
UniProt: Q8NGR8 A0A126GVC5
Position
9q33.2
AA seq 309 aa AA seqDB search
MERINHTSSVSEFILLGLSSRPEDQKTLFVLFLIVYLVTITGNLLIILAIRFNPHLQTPM
YFFLSFLSLTDICFTTSVVPKMLMNFLSEKKTISYAGCLTQMYFLYALGNSDSCLLAVMA
FDRYVAVCDPFHYVTTMSHHHCVLLVAFSCSFPHLHSLLHTLLLNRLTFCDSNVIHHFLC
DLSPVLKLSCSSIFVNEIVQMTEAPIVLVTRFLCIAFSYIRILTTVLKIPSTSGKRKAFS
TCGFYLTVVTLFYGSIFCVYLQPPSTYAVKDHVATIVYTVLSSMLNPFIYSLRNKDLKQG
LRKLMSKRS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaatcaaccacaccagcagtgtctccgagtttatcctcctgggactctcctcc
cggcctgaggaccaaaagacactctttgttctcttcctcatcgtgtacctggtcaccata
acagggaacctgctcatcatcctggccattcgcttcaacccccatcttcagacccctatg
tatttcttcttgagttttctgtctctcactgatatttgctttacaacaagcgttgtcccc
aagatgctgatgaacttcctgtcagaaaagaagaccatctcctatgctgggtgtctgaca
cagatgtattttctctatgccttgggcaacagtgacagctgccttctggcagtcatggcc
tttgaccgctatgtggccgtctgtgaccctttccactatgtcaccaccatgagccaccac
cactgtgtcctgctggtggccttctcctgctcatttcctcacctccactcactcctgcac
acacttctgctgaatcgtctcaccttctgtgactccaatgttatccaccactttctctgt
gacctcagccctgtgctgaaattgtcctgctcttccatatttgtcaatgaaattgtgcag
atgacagaagcacctattgttttggtgactcgttttctctgcattgctttctcttatata
cgaatcctcactacagttctcaagattccctctacttctgggaaacgcaaagccttctcc
acctgtggtttttacctcaccgtggtgacgctcttttatggaagcatcttctgtgtctat
ttacagcccccatccacctacgctgtcaaggaccacgtggcaacaattgtttacacagtt
ttgtcatccatgctcaatccttttatctacagcctgagaaacaaagacctgaaacagggc
ctgaggaagcttatgagcaagagatcctag

DBGET integrated database retrieval system