KEGG   Homo sapiens (human): 1390Help
Entry
1390              CDS       T01001                                 

Gene name
CREM, CREM-2, ICER, hCREM-2
Definition
(RefSeq) cAMP responsive element modulator
  KO
K09052  cAMP response element modulator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    1390 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1390 (CREM)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    1390 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf
Motif
Other DBs
NCBI-GeneID: 1390
NCBI-ProteinID: NP_853549
OMIM: 123812
HGNC: 2352
Ensembl: ENSG00000095794
Vega: OTTHUMG00000017953
Pharos: Q03060(Tbio)
UniProt: Q03060
Position
10p11.21
AA seq 300 aa AA seqDB search
MSKCARKKYIKTNPRQMTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAI
AETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIA
TMAVPTSIYQTSTGQYIAIAQGGTIQISNPGSDGVQGLQALTMTNSGAPPPGATIVQYAA
QSADGTQQFFVPGSQVVVQAATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEA
TRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaatgtgcaaggaaaaaatatattaagacaaatccaagacaaatgaccatggaa
acagttgaatcccagcatgatggaagtataacagcttctttgacagagagcaagtctgct
catgtgcagactcagactggccaaaattcaatccctgctttagctcaggtagcagcaatt
gcagagacagatgaatctgcagaatcagaaggtgtaattgattctcataaacgtagagaa
atcctttcacgaagaccctcttataggaaaatactgaatgaactgtcctctgatgtgcct
ggtgttcccaagattgaagaagagagatcagaggaagaaggaacaccacctagtattgct
accatggcagtaccaactagcatatatcagactagcacggggcaatacattgctatagcc
caaggtggaacaatccagatttctaacccaggatctgatggtgttcagggactgcaggca
ttaacaatgacaaattcaggagctcctccaccaggtgctacaattgtacagtacgcagca
caatcagctgatggcacacagcagttctttgtcccaggcagccaggttgttgttcaagct
gccactggtgacatgccaacttaccagatccgagctcctactgctgctttgccacaggga
gtggtgatggctgcatcgcccggaagtttgcacagtccccagcagctggcagaagaagca
acacgcaaacgagagctgaggctaatgaaaaacagggaagctgccaaagaatgtcgacgt
cgaaagaaagaatatgtaaaatgtctggagagccgagttgcagtgctggaagtccagaac
aagaagcttatagaggaacttgaaaccttgaaagacatttgttctcccaaaacagattac
tag

DBGET integrated database retrieval system