KEGG   Homo sapiens (human): 139065Help
Entry
139065            CDS       T01001                                 

Gene name
SLITRK4
Definition
(RefSeq) SLIT and NTRK like family member 4
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 TPKR_C2 LRRNT LRR_1
Motif
Other DBs
NCBI-GeneID: 139065
NCBI-ProteinID: NP_001171678
OMIM: 300562
HGNC: 23502
Ensembl: ENSG00000179542
Vega: OTTHUMG00000022580
Pharos: Q8IW52(Tbio)
UniProt: Q8IW52
Position
Xq27.3
AA seq 837 aa AA seqDB search
MFLWLFLILSALISSTNADSDISVEICNVCSCVSVENVLYVNCEKVSVYRPNQLKPPWSN
FYHLNFQNNFLNILYPNTFLNFSHAVSLHLGNNKLQNIEGGAFLGLSALKQLHLNNNELK
ILRADTFLGIENLEYLQADYNLIKYIERGAFNKLHKLKVLILNDNLISFLPDNIFRFASL
THLDIRGNRIQKLPYIGVLEHIGRVVELQLEDNPWNCSCDLLPLKAWLENMPYNIYIGEA
ICETPSDLYGRLLKETNKQELCPMGTGSDFDVRILPPSQLENGYTTPNGHTTQTSLHRLV
TKPPKTTNPSKISGIVAGKALSNRNLSQIVSYQTRVPPLTPCPAPCFCKTHPSDLGLSVN
CQEKNIQSMSELIPKPLNAKKLHVNGNSIKDVDVSDFTDFEGLDLLHLGSNQITVIKGDV
FHNLTNLRRLYLNGNQIERLYPEIFSGLHNLQYLYLEYNLIKEISAGTFDSMPNLQLLYL
NNNLLKSLPVYIFSGAPLARLNLRNNKFMYLPVSGVLDQLQSLTQIDLEGNPWDCTCDLV
ALKLWVEKLSDGIVVKELKCETPVQFANIELKSLKNEILCPKLLNKPSAPFTSPAPAITF
TTPLGPIRSPPGGPVPLSILILSILVVLILTVFVAFCLLVFVLRRNKKPTVKHEGLGNPD
CGSMQLQLRKHDHKTNKKDGLSTEAFIPQTIEQMSKSHTCGLKESETGFMFSDPPGQKVV
MRNVADKEKDLLHVDTRKRLSTIDELDELFPSRDSNVFIQNFLESKKEYNSIGVSGFEIR
YPEKQPDKKSKKSLIGGNHSKIVVEQRKSEYFELKAKLQSSPDYLQVLEEQTALNKI
NT seq 2514 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgtggctgtttctgattttgtcagccctgatttcttcgacaaatgcagattct
gacatatcggtggaaatttgcaatgtgtgttcctgcgtgtcagttgagaatgtgctctat
gtcaactgtgagaaggtttcagtctacagaccaaatcagctgaaaccaccttggtctaat
ttttatcacctcaatttccaaaataattttttaaatattctgtatccaaatacattcttg
aatttttcacatgcagtctccctgcatctggggaataataaactgcagaacattgaggga
ggagcctttcttgggctcagtgcattaaagcagttgcacttgaacaacaatgaattaaag
attctccgagctgacactttccttggcatagagaacttggagtatctccaggctgactac
aatttaatcaagtatattgaacgaggagccttcaataagctccacaaactgaaagttctc
attcttaatgacaatctgatttcattccttcctgataatattttccgattcgcatctttg
acccatctggatatacgagggaacagaatccagaagctcccttatatcggggttctggaa
cacattggccgtgtcgttgaattgcaactggaagataacccttggaactgtagctgtgat
ttattgcccttaaaagcttggctggagaacatgccatataacatttacataggagaagct
atctgtgaaactcccagtgacttatatggaaggcttttaaaagaaaccaacaaacaagag
ctatgtcccatgggcaccggcagtgattttgacgtgcgcatcctgcctccatctcagctg
gaaaatggctacaccactcccaatggtcacactacccaaacatctttacacagattagta
actaaaccaccaaaaacaacaaatccttccaagatctctggaatcgttgcaggcaaagcc
ctctccaaccgcaatctcagtcagattgtgtcttaccaaacaagggtgcctcctctaaca
ccttgcccggcaccttgcttctgcaaaacacacccttcagatttgggactaagtgtgaac
tgccaagagaaaaatatacagtctatgtctgaactgataccgaaacctttaaatgcgaag
aagctgcacgtcaatggcaatagcatcaaggatgtggacgtatcagacttcactgacttt
gaaggactggatttgcttcatttaggcagcaatcaaattacagtgattaagggagacgta
tttcacaatctcactaatttacgcaggctatatctcaatggcaatcaaattgagagactc
tatcctgaaatattttcaggtcttcataacctgcagtatctgtatttggaatacaatttg
attaaggaaatctcagcaggcacctttgactccatgccaaatttgcagttactgtactta
aacaataatctcctaaagagcctgcctgtttacatcttttccggagcacccttagctaga
ctgaacctgaggaacaacaaattcatgtacctgcctgtcagcggggtccttgatcagttg
caatctcttacacagattgacttggagggcaacccatgggactgtacttgtgacttggtg
gcattaaagctgtgggtggagaagttgagcgacgggattgttgtgaaagaactgaaatgt
gagacgcctgttcagtttgccaacattgaactgaagtccctcaaaaatgaaatcttatgt
cccaaacttttaaataagccgtctgcaccattcacaagccctgcacctgccattacattc
accactcctttgggtcccattcgaagtcctcctggtgggccagtgcctctgtctatttta
atcttaagtatcttagtggtcctcattttaacggtgtttgttgctttttgccttcttgtt
tttgtcctgcgacgcaacaagaaacccacagtgaagcacgaaggcctggggaatcctgac
tgtggctccatgcagctgcagctaaggaagcatgaccacaaaaccaataaaaaagatgga
ctgagcacagaagctttcattccacaaactatagaacagatgagcaagagccacacttgt
ggcttgaaagagtcagaaactgggttcatgttttcagatcctccaggacagaaagttgtt
atgagaaatgtggccgacaaggagaaagatttattacatgtagataccaggaagagactg
agcacaattgatgagctggatgaattattccctagcagggattccaatgtgtttattcag
aattttcttgaaagcaaaaaggagtataatagcataggtgtcagtggctttgagatccgc
tatccagaaaaacaaccagacaaaaaaagtaagaagtcactgataggtggcaaccacagt
aaaattgttgtggaacaaaggaagagtgagtattttgaactgaaggcgaaactgcagagt
tcccctgactacctacaggtccttgaggagcaaacagctttgaacaagatctag

DBGET integrated database retrieval system