KEGG   Homo sapiens (human): 139189Help
Entry
139189            CDS       T01001                                 

Gene name
DGKK
Definition
(RefSeq) diacylglycerol kinase kappa
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    139189 (DGKK)
   00564 Glycerophospholipid metabolism
    139189 (DGKK)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    139189 (DGKK)
   04072 Phospholipase D signaling pathway
    139189 (DGKK)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    139189 (DGKK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     139189 (DGKK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc DAGK_cat PH C1_1 Prok-RING_1 PH_3 C1_2
Motif
Other DBs
NCBI-GeneID: 139189
NCBI-ProteinID: NP_001013764
OMIM: 300837
HGNC: 32395
Ensembl: ENSG00000274588
Vega: OTTHUMG00000021520
Pharos: Q5KSL6(Tbio)
UniProt: Q5KSL6
Position
Xp11.22
AA seq 1271 aa AA seqDB search
MDRGAAAAQGTAPPQDGEQPAESPEPPPPWPPPPPPPAPPPAPPLLSEASPEPIPEPCPE
LAPGPCPEATSESATELYTEPTPEPATEPASEPAPEPATEPAPEPATEPAPEPAPEPATE
SAPEPTPEPALESVPEPAPELTPEVAPELAPEPTPEPVTELAPEFCPEAAPEFRPSPAPC
LLQCPVDTRERGLKTSPSPSPSPSPRTPMSWSRIKKILKEGPMLKNCNSFKRWKLRYFLV
QGQKLYFAHHPAFAHFETIDLSQATVAESSCRNLCHSFCVITPQRKITLAAPNRKDMEEW
INIIKTIQQGEIYKIPAAENNPFLVGMHCWYSSYSHRTQHCNVCRESIPALSRDAIICEV
CKVKSHRLCALRASKDCKWNTLSITDDLLLPADEVNMPHQWVEGNMPVSSQCAVCHESCG
SYQRLQDFRCLWCNSTVHDDCRRRFSKECCFRSHRSSVIPPTALSDPKGDGQLVVSSDFW
NLDWSSACSCPLLIFINSKSGDHQGIVFLRKFKQYLNPSQVFDLLKGGPEAGLSMFKNFA
RFRILVCGGDGSVSWVLSLIDAFGLHEKCQLAVIPLGTGNDLARVLGWGAFWNKSKSPLD
ILNRVEQASVRILDRWSVMIRETPRQTPLLKGQVEMDVPRFEAAAIQHLESAATELNKIL
KAKYPTEMIIATRFLCSAVEDFVVDIVKAWGQIKQNNTAIVSVILKSDLMYDRLSVLIDV
LAEEAAATSAEKSATEYADSSKADRKPFIPQIDHIAKCKLELATKAQSLQKSLKLIIFQV
EQALDEESRQTISVKNFSSTFFLEDDPEDINQTSPRRRSRRGTLSSISSLKSEDLDNLNL
DHLHFTPESIRFKEKCVMNNYFGIGLDAKISLDFNTRRDEHPGQYNSRLKNKMWYGLLGT
KELLQRSYRKLEERVHLECDGETISLPNLQGIVVLNITSYAGGINFWGSNTATTEYEAPA
IDDGKLEVVAIFGSVQMAMSRIINLHHHRIAQCHEVMITIDGEEGIPVQVDGEAWIQRPG
LIKIRYKNAAQMLTRDRDFENSMKMWEYKHTEIQAAPQPQLDFQDSQESLSDEEYAQMQH
LARLAENLISKLNDLSKIHQHVSVLMGSVNASANILNDIFYGQDSGNEMGAASCIPIETL
SRNDAVDVTFSLKGLYDDTTAFLDEKLLRSAEDETALQSALDAMNKEFKKLSEIDWMNPI
FVPEEKSSDTDSRSLRLKIKFPKLGKKKVEEERKPKSGQSVQSFIGNLWHRRHREDEAEG
DDPLTPSRSQL
NT seq 3816 nt NT seq  +upstreamnt  +downstreamnt
atggaccgcggagctgccgcagcccagggcactgccccgcctcaggatggagagcagccc
gctgagtctccagagcctccgccgccttggccgccgccgccaccaccaccggctccgccg
ccggctccgccgctgctctccgaggcttcgccagaacccataccagagccctgtccagag
cttgctccaggtccctgtccagaggcgacctcagaatcagccacagaactgtacacagaa
ccgaccccagaaccagccacagagccggcctcagaaccggccccagaacctgccacagag
ccggccccagaacctgccacagagccggccccagaaccggccccagaacctgccacagag
tctgccccagagccgactccagaacctgccctagagtcggtcccagagccggccccagag
ctgactccagaagttgccccagagctggccccagagccgaccccagaacctgtgacagag
ctggccccagagttctgccctgaggcggctccagagttccgtccaagtccagcaccatgt
ctattgcaatgtccggtggacactcgagagagaggtctaaagacctcgccatcgccatcg
ccatcgccatcgcccagaacgccaatgtcgtggtccagaataaagaaaatattgaaggaa
ggacctatgctgaagaactgtaactctttcaagagatggaagcttagatattttctggtt
caaggacagaagctctactttgcacaccatcccgcgtttgcacactttgaaacgattgat
ctgtctcaagccactgtggcagaaagcagctgtagaaacctttgccacagtttttgtgtt
attacaccacaacgaaaaatcactctggctgcacccaaccggaaagacatggaagaatgg
attaacatcataaaaaccatccaacagggagaaatttataagatacctgcagcagaaaac
aacccttttcttgttggaatgcattgttggtactccagttacagccaccggacccagcac
tgcaatgtttgtcgagagagcattcctgccttatctagagatgccatcatctgtgaagtg
tgcaaagtgaaatctcacagattgtgtgctttgagagcaagcaaagactgcaagtggaat
acattgtctatcactgatgacctccttctgcctgcagatgaagtaaacatgccccatcaa
tgggtagaaggaaacatgcctgtcagctctcagtgtgcagtgtgtcatgagagctgtggc
agttatcaaagacttcaagacttccgctgcctgtggtgtaattctacggtgcatgatgac
tgtaggagacggttttccaaggaatgttgcttcagaagccatcgctcatcagtcattcct
cccactgctctaagcgaccccaaaggcgatggccaattagtagtatcttcagacttctgg
aatcttgattggtcatcagcctgttcatgtcccttgctcatcttcatcaactccaaaagt
ggcgatcatcaggggatcgtcttcctccgaaaattcaagcaataccttaacccatctcaa
gtgttcgacttattgaagggtggacctgaagcagggctgtctatgttcaagaactttgct
cgctttcgcattctggtttgtggtggagatggcagcgtgagctgggtcttatctctgatt
gatgcctttggattacatgaaaagtgtcagttggcagtcatcccacttggaaccggcaat
gatctggctcgtgttctgggctggggtgcattctggaacaaaagcaagtcacctctggac
atcctcaacagagtggagcaggctagtgtgaggatcctagacagatggagtgtgatgatt
cgtgagactcccagacaaaccccgctgctaaaaggacaggttgaaatggatgtaccacga
tttgaggctgctgccatccaacacttagaatctgcagccaccgagttgaacaaaatcctg
aaggccaagtaccccacagagatgatcatcgcaaccagattcttgtgttcagctgtggaa
gattttgtggttgatattgtaaaggcctggggtcagataaaacagaacaacactgcaata
gtgtctgtgattttgaaaagtgacttaatgtatgataggctcagtgtcctgatcgatgtc
ctggctgaggaggcagcagctacttctgctgaaaaaagtgctacagaatatgcagacagc
agcaaggcagataggaagcccttcattcctcaaatagaccacatagccaagtgcaagttg
gagctggctacaaaggcccagagtctccagaaatccttgaaactcatcatatttcaagtt
gaacaagctctggatgaggaaagcagacagacaatatctgttaagaactttagttcaact
ttcttcctggaagatgacccagaagatattaaccagacaagcccacgacgccgttctcgt
cgtggcactttgtcttctatatcttctctcaaaagtgaggacctggacaaccttaacttg
gatcacttacattttacacctgaatctatacgcttcaaagaaaaatgtgtcatgaacaac
tacttcggaattggactggatgctaaaatttctctggacttcaacaccagaagagatgaa
cacccagggcaatacaatagccgccttaagaacaagatgtggtatggccttctgggaacc
aaagaacttttgcagcgctcttacaggaaactggaagaacgagtgcatttggagtgtgat
ggagaaaccatctccttgccaaacctgcaaggcattgtagtgctcaacattaccagctat
gctggaggtatcaacttctggggaagcaacacagcaaccacggaatatgaggctcctgca
atcgatgatgggaaactggaggtggtggcaatctttggttctgtgcagatggcaatgtcc
cgtatcatcaacctgcatcatcatcgcattgcccagtgccatgaggtgatgataaccatt
gatggtgaagaaggtatcccagtgcaggtggatggggaggcctggattcagagaccaggc
cttatcaaaattagatacaagaacgctgcccagatgctgacaagagatcgggactttgag
aactcaatgaaaatgtgggaatacaagcatactgaaattcaagctgcccctcaaccccag
ctggacttccaggactctcaagagagcctctctgacgaggagtatgcccagatgcagcac
ttagctcggcttgcagaaaacctcatcagcaaacttaatgacctgagcaagatccaccag
catgtgtctgtcctcatgggttctgtgaatgccagcgctaacatcctgaatgatatattt
tacggccaagacagtggcaatgagatgggtgcagcttcctgtattcccattgaaactcta
agcagaaatgatgccgtagatgttacatttagtcttaaaggtctctacgatgacaccaca
gctttcctggatgaaaagctgctgagaagtgctgaggatgagactgcactacaaagcgcc
ctggatgccatgaataaggagttcaaaaagctatctgagattgactggatgaatccaatc
tttgttccagaggaaaaatcttcggacactgacagtagaagcctcaggctgaaaattaag
ttccccaaattgggaaagaaaaaggtagaagaggaacgcaagcctaaatcaggccagagt
gtccagagttttattggcaatttatggcaccgcagacatcgtgaagatgaagcagagggt
gatgatcctctaacaccatcgagatctcaactgtag

KEGG   Homo sapiens (human): 1606Help
Entry
1606              CDS       T01001                                 

Gene name
DGKA, DAGK, DAGK1, DGK-alpha
Definition
(RefSeq) diacylglycerol kinase alpha
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    1606 (DGKA)
   00564 Glycerophospholipid metabolism
    1606 (DGKA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    1606 (DGKA)
   04072 Phospholipase D signaling pathway
    1606 (DGKA)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    1606 (DGKA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     1606 (DGKA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc DAG_kinase_N DAGK_cat C1_1 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 C1_2
Motif
Other DBs
NCBI-GeneID: 1606
NCBI-ProteinID: NP_001336
OMIM: 125855
HGNC: 2849
Ensembl: ENSG00000065357
Vega: OTTHUMG00000170109
Pharos: P23743(Tbio)
UniProt: P23743 A0A024RB23
Structure
PDB: 

Position
12q13.2
AA seq 735 aa AA seqDB search
MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIY
LEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFK
LYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEW
VRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKY
TVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHC
VWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNL
STSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRL
FKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQ
NLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIM
REKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVL
NIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLE
GAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPML
MGPPPRSTNFFGFLS
NT seq 2208 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggagaggggcctaataagccccagtgattttgcccagctgcaaaaatacatg
gaatactccaccaaaaaggtcagtgatgtcctaaagctcttcgaggatggcgagatggct
aaatatgtccaaggagatgccattgggtacgagggattccagcaattcctgaaaatctat
ctcgaagtggataatgttcccagacacctaagcctggcactgtttcaatcctttgagact
ggtcactgcttaaatgagacaaatgtgacaaaagatgtggtgtgtctcaatgatgtttcc
tgctacttttcccttctggagggtggtcggccagaagacaagttagaattcaccttcaag
ctgtacgacacggacagaaatgggatcctggacagctcagaagtggacaaaattatccta
cagatgatgcgagtggctgaatacctggattgggatgtgtctgagctgaggccgattctt
caggagatgatgaaagagattgactatgatggcagtggctctgtctctcaagctgagtgg
gtccgggctggggccaccaccgtgccactgctagtgctgctgggtctggagatgactctg
aaggacgacggacagcacatgtggaggcccaagaggttccccagaccagtctactgcaat
ctgtgcgagtcaagcattggtcttggcaaacagggactgagctgtaacctctgtaagtac
actgttcacgaccagtgtgccatgaaagccctgccttgtgaagtcagcacctatgccaag
tctcggaaggacattggtgtccaatcacatgtgtgggtgcgaggaggctgtgagtccggg
cgctgcgaccgctgtcagaaaaagatccggatctaccacagtctgaccgggctgcattgt
gtatggtgccacctagagatccacgatgactgcctgcaagcggtgggccatgagtgtgac
tgtgggctgctccgggatcacatcctgcctccatcttccatctatcccagtgtcctggcc
tctggaccggatcgtaaaaatagcaaaacaagccagaagaccatggatgatttaaatttg
agcacctctgaggctctgcggattgaccctgttcctaacacccacccacttctcgtcttt
gtcaatcctaagagtggcgggaagcaggggcaaagggtgctctggaagttccagtatata
ttaaaccctcgacaggtgttcaacctcctaaaggatggtcctgagatagggctccgatta
ttcaaggatgttcctgatagccggattttggtgtgtggtggagacggcacagtaggctgg
attctagagaccattgacaaagctaacttgccagttttgcctcctgttgctgtgttgccc
ctgggtactggaaatgatctggctcgatgcctaagatggggaggaggttatgaaggacag
aatctggcaaagatcctcaaggatttagagatgagtaaagtggtacatatggatcgatgg
tctgtggaggtgatacctcaacaaactgaagaaaaaagtgacccagtcccctttcaaatc
atcaataactacttctctattggcgtggatgcctctattgctcatcgattccacatcatg
cgagagaaatatccggagaagttcaacagcagaatgaagaacaagctatggtacttcgaa
tttgccacatctgaatccatcttctcaacatgcaaaaagctggaggagtctttgacagtt
gagatctgtgggaaaccgctggatctgagcaacctgtccctagaaggcatcgcagtgcta
aacatccctagcatgcatggtggctccaacctctggggtgataccaggagaccccatggg
gatatctatgggatcaaccaggccttaggtgctacagctaaagtcatcaccgaccctgat
atcctgaaaacctgtgtaccagacctaagtgacaagagactggaagtggttgggctggag
ggtgcaattgagatgggccaaatctataccaagctcaagaatgctggacgtcggctggcc
aagtgctctgagatcaccttccacaccacaaaaacccttcccatgcaaattgacggagaa
ccctggatgcagacgccctgtacaatcaagatcacccacaagaaccagatgcccatgctc
atgggcccacccccccgctccaccaatttctttggcttcttgagctaa

KEGG   Homo sapiens (human): 1607Help
Entry
1607              CDS       T01001                                 

Gene name
DGKB, DAGK2, DGK, DGK-BETA
Definition
(RefSeq) diacylglycerol kinase beta
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    1607 (DGKB)
   00564 Glycerophospholipid metabolism
    1607 (DGKB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    1607 (DGKB)
   04072 Phospholipase D signaling pathway
    1607 (DGKB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    1607 (DGKB)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     1607 (DGKB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc DAG_kinase_N DAGK_cat C1_1 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8 SPARC_Ca_bdg C1_2
Motif
Other DBs
NCBI-GeneID: 1607
NCBI-ProteinID: NP_663733
OMIM: 604070
HGNC: 2850
Ensembl: ENSG00000136267
Vega: OTTHUMG00000152477
Pharos: Q9Y6T7(Tbio)
UniProt: Q9Y6T7
Position
7p21.2
AA seq 773 aa AA seqDB search
MTNQEKWAHLSPSEFSQLQKYAEYSTKKLKDVLEEFHGNGVLAKYNPEGKQDILNQTIDF
EGFKLFMKTFLEAELPDDFTAHLFMSFSNKFPHSSPMVKSKPALLSGGLRMNKGAITPPR
TTSPANTCSPEVIHLKDIVCYLSLLERGRPEDKLEFMFRLYDTDGNGFLDSSELENIISQ
MMHVAEYLEWDVTELNPILHEMMEEIDYDHDGTVSLEEWIQGGMTTIPLLVLLGLENNVK
DDGQHVWRLKHFNKPAYCNLCLNMLIGVGKQGLCCSFCKYTVHERCVARAPPSCIKTYVK
SKRNTDVMHHYWVEGNCPTKCDKCHKTVKCYQGLTGLHCVWCQITLHNKCASHLKPECDC
GPLKDHILPPTTICPVVLQTLPTSGVSVPEERQSTVKKEKSGSQQPNKVIDKNKMQRANS
VTVDGQGLQVTPVPGTHPLLVFVNPKSGGKQGERIYRKFQYLLNPRQVYSLSGNGPMPGL
NFFRDVPDFRVLACGGDGTVGWVLDCIEKANVGKHPPVAILPLGTGNDLARCLRWGGGYE
GENLMKILKDIENSTEIMLDRWKFEVIPNDKDEKGDPVPYSIINNYFSIGVDASIAHRFH
IMREKHPEKFNSRMKNKFWYFEFGTSETFSATCKKLHESVEIECDGVQIDLINISLEGIA
ILNIPSMHGGSNLWGESKKRRSHRRIEKKGSDKRTTVTDAKELKFASQDLSDQLLEVVGL
EGAMEMGQIYTGLKSAGRRLAQCSCVVIRTSKSLPMQIDGEPWMQTPCTVSTE
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaccaggaaaaatgggcccacctcagcccttcggaattttcccaacttcagaaa
tatgctgagtattctacaaagaaattaaaggatgttcttgaagaattccatggtaatggt
gtgcttgcaaagtataatcctgaagggaaacaagacattcttaaccaaacaatagatttt
gaaggtttcaaactattcatgaagacattcctggaagccgagcttcctgatgatttcact
gcacaccttttcatgtcatttagcaacaagtttcctcattctagtccaatggtaaaaagt
aagcctgctctcctatcaggcggtctgagaatgaataaaggtgccatcacccctccccgg
actacttctcctgcaaatacgtgttccccagaagtaatccatctgaaggacattgtctgt
tacctgtctctgcttgaaagaggaagacctgaggataagcttgagtttatgtttcgcctt
tatgacacggatgggaatggcttcctggacagctcggagctagaaaatatcatcagtcag
atgatgcatgttgcagaataccttgagtgggatgtcactgaacttaatccaatcctccat
gaaatgatggaagaaattgactatgatcatgatggaaccgtgtctctggaggaatggatt
caaggaggaatgacaacgattccacttcttgtgctcctgggcttagaaaataacgtgaag
gatgatggacagcacgtgtggcgactgaagcactttaacaaacctgcctattgcaacctt
tgcctgaacatgctgattggcgtggggaagcagggcctctgctgttccttctgcaagtac
acagtccatgagcgctgtgtggctcgagcacctccctcttgcatcaagacctatgtgaag
tccaaaaggaacactgatgtcatgcaccattactgggttgaaggtaactgcccaaccaag
tgtgataagtgccacaaaactgttaaatgttaccagggcctgacaggactgcattgtgtt
tggtgtcagatcacactgcataataaatgtgcttctcatctaaaacctgaatgtgactgt
ggacctttgaaggaccatattttaccacccacaacaatctgtccagtggtactgcagact
ctgcccacttcaggagtttcagttcctgaggaaagacaatcaacagtgaaaaaggaaaag
agtggttcccagcagccaaacaaagtgattgacaagaataaaatgcaaagagccaactct
gttactgtagatggacaaggcctgcaggtcactcctgtgcctggtactcacccactttta
gtttttgtgaaccccaaaagtggtggaaaacaaggagaacgaatttacagaaaattccag
tatctattaaatcctcgtcaggtttacagtctttctggaaatggaccaatgccagggtta
aactttttccgtgatgttcctgacttcagagtgttagcctgtggtggagatggaaccgtg
ggctgggttttggattgcatagaaaaggccaatgtaggcaagcatcctccagttgcgatt
ctgcctcttgggactggcaatgatctagcaagatgcctgcgatggggaggaggttacgaa
ggtgagaatctgatgaaaattctaaaagacattgaaaacagcacagaaatcatgttggac
aggtggaagtttgaagtcatacctaatgacaaagatgagaaaggagacccagtgccttac
agtatcatcaataattacttttccattggcgtggatgcctccattgcacacagattccac
atcatgagagaaaaacacccagagaaattcaacagtagaatgaagaacaaattttggtat
tttgagtttggcacatctgaaactttctcagccacctgcaagaagctacatgaatctgta
gaaatagaatgtgatggagtacagatagatttaataaacatctctctggaaggaattgct
attttgaatataccaagcatgcatggaggatccaatctttggggagagtctaagaaaaga
cgaagccatcgacgaatagagaaaaaagggtctgacaaaaggaccaccgtcacagatgcc
aaagagttgaagtttgcaagtcaagatctcagtgaccagctgctggaggtggtcggcttg
gaaggagccatggagatggggcaaatatacacaggcctgaaaagtgctggccggcggctg
gctcagtgctcctgcgtggtcatcaggacgagcaagtctctgccaatgcaaattgatggg
gagccatggatgcagaccccatgcacagtgagtacagagtag

KEGG   Homo sapiens (human): 1608Help
Entry
1608              CDS       T01001                                 

Gene name
DGKG, DAGK3, DGK-GAMMA
Definition
(RefSeq) diacylglycerol kinase gamma
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    1608 (DGKG)
   00564 Glycerophospholipid metabolism
    1608 (DGKG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    1608 (DGKG)
   04072 Phospholipase D signaling pathway
    1608 (DGKG)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    1608 (DGKG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     1608 (DGKG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc DAG_kinase_N DAGK_cat C1_1 EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg
Motif
Other DBs
NCBI-GeneID: 1608
NCBI-ProteinID: NP_001337
OMIM: 601854
HGNC: 2853
Ensembl: ENSG00000058866
Vega: OTTHUMG00000156617
Pharos: P49619(Tbio)
UniProt: P49619
Position
3q27.2-q27.3
AA seq 791 aa AA seqDB search
MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPISYDVFKLFMR
AYLEVDLPQPLSTHLFLAFSQKPRHETSDHPTEGASNSEANSADTNIQNADNATKADEAC
APDTESNMAEKQAPAEDQVAATPLEPPVPRSSSSESPVVYLKDVVCYLSLLETGRPQDKL
EFMFRLYDSDENGLLDQAEMDCIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGFV
SLQEWVHGGMTTIPLLVLLGMDDSGSKGDGRHAWTMKHFKKPTYCNFCHIMLMGVRKQGL
CCTYCKYTVHERCVSRNIPGCVKTYSKAKRSGEVMQHAWVEGNSSVKCDRCHKSIKCYQS
VTARHCVWCRMTFHRKCELSTLCDGGELRDHILLPTSICPITRDRPGEKSDGCVSAKGEL
VMQYKIIPTPGTHPLLVLVNPKSGGRQGERILRKFHYLLNPKQVFNLDNGGPTPGLNFFR
DTPDFRVLACGGDGTVGWILDCIDKANFAKHPPVAVLPLGTGNDLARCLRWGGGYEGGSL
TKILKDIEQSPLVMLDRWHLEVIPREEVENGDQVPYSIMNNYFSIGVDASIAHRFHVMRE
KHPEKFNSRMKNKLWYFEFGTSETFAATCKKLHDHIELECDGVGVDLSNIFLEGIAILNI
PSMYGGTNLWGENKKNRAVIRESRKGVTDPKELKFCVQDLSDQLLEVVGLEGAMEMGQIY
TGLKSAGRRLAQCASVTIRTNKLLPMQVDGEPWMQPCCTIKITHKNQAPMMMGPPQKSSF
FSLRRKSRSKD
NT seq 2376 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagaacggtgggtctccctcactccagaagaatttgaccaactccagaaatat
tcagaatattcctccaagaagataaaagatgccttgactgaatttaatgagggtgggagc
ctcaaacaatatgacccacatgagccgattagctatgatgtcttcaagctgttcatgagg
gcgtacctggaggtggaccttccccagccactgagcactcacctcttcctggccttcagc
cagaagcccagacacgagacctctgaccacccgacggagggagccagcaacagtgaggcc
aacagcgcagatactaatatacagaatgcagataatgccaccaaagcagacgaggcctgt
gcccctgatactgaatcaaatatggctgagaagcaagcaccagctgaagaccaagtggct
gcgacccccctggaaccccccgtccctcggtcttcaagctcggaatccccagtggtatac
ctgaaggatgttgtgtgctacctgtccctgctggagacggggaggcctcaggataagctg
gagttcatgtttcgcctctatgattcagatgagaacggtctcctggaccaagcggagatg
gattgcattgtcaaccaaatgctgcatattgcccagtacctggagtgggatcccacagag
ctgaggcctatattgaaggagatgctgcaagggatggactacgaccgggacggctttgtg
tctctacaggaatgggtccatggagggatgaccaccatcccattgctggtcctcctgggg
atggatgactctggctccaagggggatgggcggcacgcctggaccatgaagcacttcaag
aaaccaacctactgcaacttctgccatatcatgctcatgggcgtccgcaagcaaggcctg
tgctgcacttactgtaaatacactgtccacgaacgctgtgtgtccagaaacattcctggt
tgtgtcaaaacgtactcaaaagccaaaaggagtggtgaggtgatgcagcacgcatgggtg
gaagggaactcctccgtcaagtgtgaccggtgccacaaaagtatcaagtgctaccagagt
gtcaccgcgcggcactgcgtgtggtgccggatgacgtttcaccgcaaatgtgaattatca
acgttgtgtgacggtggggaactcagagaccacatcttactgcccacctccatatgcccc
atcacccgggacaggccaggtgagaagtctgatggctgcgtgtccgccaagggcgaactt
gtcatgcagtataagatcatccccaccccgggtacccaccccctgctggtcttggtgaac
cccaagagtggagggagacaaggagaaagaattcttcggaaattccactatctgctcaac
cccaaacaagttttcaacctggacaatggggggcctactccagggttgaactttttccgt
gatactccagacttccgtgttttggcctgtggtggagatgggacagttggctggattttg
gattgcattgataaggccaactttgcaaagcatccaccagtggctgtcctgcctcttgga
acaggaaatgaccttgcccgttgtctccgctggggaggaggttatgaagggggcagcttg
acaaaaatcctgaaagacattgagcagagccccttggtgatgctggaccgctggcatctg
gaagtcatccccagagaggaagtggaaaacggggaccaggtcccatacagcatcatgaac
aactatttctccattggtgtggacgcttccattgcacacagattccatgtgatgagagag
aaacatcctgaaaaattcaacagcaggatgaagaacaagctgtggtactttgaatttggc
acctcggagacttttgcagcgacctgcaagaaactccacgaccacattgagttggagtgt
gatggggttggggtggacctgagcaacatcttcctggaaggcattgccattctcaacatt
cccagcatgtacggaggcaccaatctctggggagaaaacaagaagaaccgggctgtgatc
cgggaaagcaggaagggtgtcactgaccccaaagaactgaaattctgcgttcaagacctc
agtgaccagctccttgaagtggtggggctagaaggagccatggagatggggcagatctac
accggcctgaagagtgcaggcaggaggctggcccagtgcgcctctgtcaccatcaggaca
aacaagctgctgccaatgcaagtggatggagaaccctggatgcagccatgttgcacgatt
aaaattactcacaagaaccaagcgcccatgatgatggggcctccccagaagagcagcttc
ttctcgttgagaaggaagagccgttcaaaagactaa

KEGG   Homo sapiens (human): 160851Help
Entry
160851            CDS       T01001                                 

Gene name
DGKH, DGKeta
Definition
(RefSeq) diacylglycerol kinase eta
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    160851 (DGKH)
   00564 Glycerophospholipid metabolism
    160851 (DGKH)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    160851 (DGKH)
   04072 Phospholipase D signaling pathway
    160851 (DGKH)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    160851 (DGKH)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     160851 (DGKH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc DAGK_cat SAM_2 C1_1 PH SAM_1 PH_8 C1_2 PH_11 Mcp5_PH SAM_PNT
Motif
Other DBs
NCBI-GeneID: 160851
NCBI-ProteinID: NP_821077
OMIM: 604071
HGNC: 2854
Ensembl: ENSG00000102780
Vega: OTTHUMG00000016804
Pharos: Q86XP1(Tbio)
UniProt: Q86XP1
Position
13q14.11
AA seq 1220 aa AA seqDB search
MAGAGGQHHPPGAAGGAAAGAGAAVTSAAASAGPGEDSSDSEAEQEGPQKLIRKVSTSGQ
IRTKTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVAEAST
KNANNSFTIITPFRRLMLCAENRKEMEDWISSLKSVQTREPYEVAQFNVEHFSGMHNWYA
CSHARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIED
EDGVAMPHQWLEGNLPVSAKCAVCDKTCGSVLRLQDWKCLWCKTMVHTACKDLYHPICPL
GQCKVSIIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPA
QVFDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQCQLGVLPLGTG
NDLARVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPPKASLLPGPPEAS
EEFYMTIYEDSVATHLTKILNSDEHAVVISSAKTLCETVKDFVAKVEKTYDKTLENAVVA
DAVASKCSVLNEKLEQLLQALHTDSQAAPVLPGLSPLIVEEDAVESSSEESLGESKEQLG
DDVTKPSSQKAVKPREIMLRANSLKKAVRQVIEEAGKVMDDPTVHPCEPANQSSDYDSTE
TDESKEEAKDDGAKESITVKTAPRSPDARASYGHSQTDSVPGPAVAASKENLPVLNTRII
CPGLRAGLAASIAGSSIINKMLLANIDPFGATPFIDPDLDSVDGYSEKCVMNNYFGIGLD
AKISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLP
SLQGIAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAIFDSMQMAVSRVIKLQH
HRIAQCRTVKITIFGDEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWE
DKQKCDSGKPVLRTHLYIHHAIDLATEEVSQMQLCSQAAEELITRICDAATIHCLLEQEL
AHAVNACSHALNKANPRCPESLTRDTATEIAINVKALYNETESLLVGRVPLQLESPHEER
VSNALHSVEVELQKLTEIPWLYYILHPNEDEEPPMDCTKRNNRSTVFRIVPKFKKEKVQK
QKTSSQPVQKWGTEEVAAWLDLLNLGEYKDIFIRHDIRGAELLHLERRDLKDLGIPKVGH
VKRILQGIKELGRSTPQSEV
NT seq 3663 nt NT seq  +upstreamnt  +downstreamnt
atggcaggggccggaggccagcaccaccctccgggcgccgctggaggagcggccgccgga
gccggcgccgcggtcacctccgccgctgcctcggcggggccgggagaggattcgtctgac
agcgaagcggagcaagagggaccccagaaactgatccgcaaagtgtctacctcggggcag
atccggaccaagaccagtattaaagagggacagctattgaagcaaaccagttctttccaa
aggtggaaaaagcgatacttcaaacttcgaggccgcaccctttactatgcaaaggactca
aagtctctgatatttgatgaagttgacctctcagatgctagtgtagctgaagcaagcacg
aaaaatgctaacaacagcttcacgatcatcactccattcagaaggctaatgctgtgtgct
gagaacagaaaggagatggaggattggatcagctcactgaagtctgtacagaccagagaa
ccctacgaggtggcccagtttaatgtggaacatttctcagggatgcacaactggtacgcc
tgctcccacgcccgacccaccttctgtaacgtgtgcagagagagtctttctggagtcacc
tcccatggcctgtcctgcgaagtgtgtaaattcaaggctcacaaaagatgtgcagtgaga
gcaacaaataactgtaaatggactaccctggcctccatcgggaaggacattatagaagat
gaagatggcgtcgcgatgcctcaccagtggcttgagggcaacctgcctgtaagtgccaag
tgtgctgtctgcgacaaaacatgtggcagtgttctccgtctacaggattggaaatgcctt
tggtgtaagacaatggtacacactgcctgcaaagatttataccatccaatatgtccactt
ggtcaatgtaaagtatctatcatacctccaattgcactaaacagcaccgattccgatggt
ttctgtagagcaacattttcgttctgtgttagtcctctattggtttttgtcaattctaag
agtggagataatcagggagtaaagttcctccgtcgctttaaacagttgctaaatccggct
caggtgtttgatttaatgaatggaggtcctcatttaggtttaagattatttcagaagttt
gacaatttccggattcttgtttgtggaggcgatggaagtgtaggttgggttttgtcagaa
atcgataagctcaacttgaataaacagtgtcagctgggagtgttgcctttgggtacagga
aatgaccttgcccgagttcttggctggggaggttcatatgacgatgacacccaacttcct
cagatcctagagaaactggaacgagccagtaccaaaatgttggacaggtggagtataatg
acatatgaactcaaattgccaccaaaagcttccctacttccaggacctccagaagcatct
gaagaattttatatgacgatttatgaagactcagttgcaacgcatcttacaaaaatcctc
aattctgatgaacatgcagtggtcatatcttctgccaagacgctatgtgaaactgtaaag
gacttcgttgccaaagtagaaaagacgtatgacaaaaccttggaaaatgccgttgtagct
gatgccgtggccagtaaatgttcagtcctaaacgagaagctcgaacaactgctgcaggct
ttgcacacagattcccaggctgcgcctgttctccctggcctcagccctctcattgtggaa
gaagatgctgtggaatcgtccagtgaagagtccctgggtgaaagcaaagagcagcttggg
gatgacgttacaaaaccttcctcccagaaagccgtcaaaccaagggaaatcatgttgcgg
gcaaatagtttaaagaaagcagtgaggcaagtcattgaggaagccggaaaagttatggat
gacccgacagttcacccctgtgaaccagctaatcagtcctctgattatgacagcacagaa
acagatgaatctaaggaggaagctaaagatgatggtgccaaagaatcaataactgttaaa
actgcacctcggtctccagatgcccgggcaagttatggccattcccaaactgattctgtc
cctggtccagctgtggcagccagcaaagaaaacctccctgtgctcaataccagaataatc
tgcccaggtttaagagcaggactggctgcctcaattgctgggagttcgattatcaacaaa
atgttactggcaaacattgatccttttggtgccacgccgtttattgacccggatctagat
tccgtagatggatattcagaaaaatgtgtcatgaacaattactttgggattggattagat
gcaaaaatttcattagaatttaataataaaagagaggagcaccctgaaaaatgcaggagc
cgaactaaaaacttgatgtggtatggagtccttggaacccgggagttattacagagatcg
tacaagaatttagaacaaagggttcaacttgagtgtgatgggcagtatattcctcttccc
agcttgcaaggcatagccgtgttgaacattcccagctatgctggaggcactaacttttgg
ggtggaactaaagaggatgatatatttgctgcaccatcctttgatgacaagatcctggaa
gttgtagcaatatttgatagcatgcaaatggcagtttcaagggtcattaaactgcagcat
catcgaatagcccagtgccgtacagtgaaaatcactatatttggtgacgaaggagtccca
gtgcaagtggatggtgaagcgtgggttcagcctccagggattatcaaaattgtgcacaaa
aacagagcacaaatgctaacaagggacagagcctttgagagcactctgaaatcttgggaa
gataagcagaagtgtgattctggtaaaccagttctccgaacccatttgtacatccatcac
gccattgacttggcaacagaagaggtgtcgcagatgcagctatgctcccaggctgcagag
gagctcattactaggatatgtgacgcagccacaattcactgtcttttggagcaagaactg
gcccatgctgtgaatgcctgctcccatgccctgaataaagccaacccaaggtgcccggag
agtcttacaagagacactgccactgaaatagccatcaatgtgaaggcgctgtataatgaa
acagaatctttgctagttggcagggttcctttgcagctggaatcgccacatgaagagcga
gtatccaatgccttacactctgtggaggtggaattacagaaactgacagagattccttgg
ctttattatatcttacacccaaatgaggatgaggaacctcctatggattgcaccaaaagg
aacaacagaagcaccgtatttcgaatagtgccaaagtttaaaaaggaaaaggttcagaag
cagaagacaagttcacagcctgttcagaaatggggcacagaggaagttgctgcttggctg
gatctgctcaatttgggagagtacaaagatatcttcatccgtcatgacatcagaggggct
gaacttttgcatctggaaaggcgagatcttaaggatctggggataccgaaagtgggtcat
gtgaagcgaattctccagggaattaaagagcttggaaggagcactccacagtcggaggtg
taa

KEGG   Homo sapiens (human): 1609Help
Entry
1609              CDS       T01001                                 

Gene name
DGKQ, DAGK, DAGK4, DAGK7
Definition
(RefSeq) diacylglycerol kinase theta
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    1609 (DGKQ)
   00564 Glycerophospholipid metabolism
    1609 (DGKQ)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    1609 (DGKQ)
   04072 Phospholipase D signaling pathway
    1609 (DGKQ)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    1609 (DGKQ)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     1609 (DGKQ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc RA C1_1 DAGK_cat C1_2
Motif
Other DBs
NCBI-GeneID: 1609
NCBI-ProteinID: NP_001338
OMIM: 601207
HGNC: 2856
Ensembl: ENSG00000145214
Vega: OTTHUMG00000088629
Pharos: P52824(Tbio)
UniProt: P52824 A0A140VKC1 Q59FF7
Position
4p16.3
AA seq 942 aa AA seqDB search
MAAAAEPGARAWLGGGSPRPGSPACSPVLGSGGRARPGPGPGPGPERAGVRAPGPAAAPG
HSFRKVTLTKPTFCHLCSDFIWGLAGFLCDVCNFMSHEKCLKHVRIPCTSVAPSLVRVPV
AHCFGPRGLHKRKFCAVCRKVLEAPALHCEVCELHLHPDCVPFACSDCRQCHQDGHQDHD
THHHHWREGNLPSGARCEVCRKTCGSSDVLAGVRCEWCGVQAHSLCSAALAPECGFGRLR
SLVLPPACVRLLPGGFSKTQSFRIVEAAEPGEGGDGADGSAAVGPGRETQATPESGKQTL
KIFDGDDAVRRSQFRLVTVSRLAGAEEVLEAALRAHHIPEDPGHLELCRLPPSSQACDAW
AGGKAGSAVISEEGRSPGSGEATPEAWVIRALPRAQEVLKIYPGWLKVGVAYVSVRVTPK
STARSVVLEVLPLLGRQAESPESFQLVEVAMGCRHVQRTMLMDEQPLLDRLQDIRQMSVR
QVSQTRFYVAESRDVAPHVSLFVGGLPPGLSPEEYSSLLHEAGATKATVVSVSHIYSSQG
AVVLDVACFAEAERLYMLLKDMAVRGRLLTALVLPDLLHAKLPPDSCPLLVFVNPKSGGL
KGRDLLCSFRKLLNPHQVFDLTNGGPLPGLHLFSQVPCFRVLVCGGDGTVGWVLGALEET
RYRLACPEPSVAILPLGTGNDLGRVLRWGAGYSGEDPFSVLLSVDEADAVLMDRWTILLD
AHEAGSAENDTADAEPPKIVQMSNYCGIGIDAELSLDFHQAREEEPGKFTSRLHNKGVYV
RVGLQKISHSRSLHKQIRLQVERQEVELPSIEGLIFINIPSWGSGADLWGSDSDTRFEKP
RMDDGLLEVVGVTGVVHMGQVQGGLRSGIRIAQGSYFRVTLLKATPVQVDGEPWVQAPGH
MIISAAGPKVHMLRKAKQKPRRAGTTRDARADAAPAPESDPR
NT seq 2829 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggccgagcccggggcccgcgcctggctgggcggcggctccccgcgcccc
ggcagcccggcctgcagccccgtgctgggctcaggaggccgcgcgcgcccggggccgggg
ccggggccgggacccgagcgggcgggcgtcagagccccgggccccgctgccgcgccggga
cacagcttccggaaggtgacgctcaccaagcccaccttctgccacctctgctccgacttc
atctgggggctggccggcttcctgtgcgacgtctgcaatttcatgtctcatgagaagtgc
ctgaagcacgtgaggatcccgtgcacgagtgtggcacccagcctggtccgggttcctgta
gcccactgcttcggcccccgggggctccacaagcgcaagttctgtgctgtctgccgcaag
gtcctggaggcaccggcgctccactgcgaagtgtgtgagctgcacctccacccagactgt
gtgcccttcgcctgcagtgactgccgccagtgccaccaggatgggcaccaggatcacgac
acccatcaccaccactggcgggaggggaacctgccctcgggagcgcgctgcgaggtctgc
aggaagacgtgcggctcctctgacgtgctggccggcgtgcgctgcgagtggtgcggggtc
caggcgcactccctctgctccgcggcgctggctcccgagtgtggcttcgggcgtctgcgc
tccctggtcctgcctcccgcgtgcgtgcgccttctgcccggcggcttcagcaagacgcag
agcttccgcatcgtggaggccgcggagccgggcgaggggggcgacggcgccgacgggagc
gctgccgtgggtccaggcagagagacacaggcaactccggagtccgggaagcaaacgctg
aagatctttgatggcgacgacgcggtgagaagaagccagttccgcctcgtcacggtgtcc
cgcctggccggtgccgaggaggtgctggaggccgcactgcgggcccaccacatccccgag
gaccctggccacctggagctgtgccggctgcccccttcctctcaggcctgtgacgcctgg
gctgggggcaaggctgggagtgctgtgatctcggaggagggcagaagccccgggtccggc
gaggccacgccagaggcctgggtcatccgggctctgccgcgggcccaggaggtcctgaag
atctaccctggctggctcaaggtgggcgtggcctacgtgtccgtgcgagtgaccccgaag
agcacggcccgctctgtggtgctggaggtcctgccgctgctcggccgccaggccgagagt
cccgagagcttccagctggtggaggtggcgatgggctgcaggcacgtccagcggacgatg
ctgatggacgaacagcccctgctggaccggctacaggacatccggcagatgtctgtgcgg
caggtgagccagacgcggttctacgtggcagagagcagggatgtagccccgcacgtctcc
ctgtttgttggcggcctgcctcccggcctgtctcccgaggagtacagcagcctgctgcat
gaggccggggctaccaaagccaccgtggtgtccgtgagtcacatctactcctcccaaggc
gcggtagtgttggacgttgcctgctttgcggaggccgagcggctgtacatgctgctgaag
gacatggctgtgcggggccggctgctcactgccctggtgctccccgacctgctgcacgcg
aagctgcccccagacagctgtcccctccttgtgttcgtgaaccccaagagtggaggcctc
aagggccgagacctgctctgcagcttccggaagctactgaaccctcatcaggtcttcgac
ctgaccaacggaggtcctcttcccgggctccacctgttctcccaggtgccctgcttccgg
gtgctggtgtgtggtggcgatggcactgtgggctgggtgcttggcgccctggaggagaca
cggtaccgactggcctgcccggagccttctgtggccatcctgcccctgggcacagggaat
gaccttggtcgagtcctccgctggggggcgggctacagcggcgaggacccgttctccgta
ctgctgtctgtggacgaggccgacgccgtgctcatggaccgctggaccatcctgctggat
gcccacgaggctggcagtgcagagaacgacacggcagacgcagagccccccaagatcgtg
cagatgagtaactactgtggcattggcatcgacgcggagctgagcctggacttccaccag
gcacgggaagaggagcctggcaagttcacaagcaggctgcacaacaagggtgtgtacgtg
cgggtggggctgcagaagatcagtcactctcggagcctgcacaagcagatccggctgcag
gtggagcggcaggaggtggagctgcccagtattgaaggcctcatcttcatcaacatcccc
agctggggctcgggggccgacctgtggggctccgacagcgacaccaggtttgagaagcca
cgcatggacgacgggctgctggaggttgtgggcgtgacgggcgtcgtgcacatgggccag
gtccagggtgggctgcgctccggaatccggattgcccagggttcctacttccgagtcacg
ctcctcaaggccaccccggtgcaggtggacggggagccctgggtccaggccccggggcac
atgatcatctcagctgctggccctaaggtgcacatgctgaggaaggccaagcagaagccg
aggagggccgggaccaccagggatgcccgggcggatgctgcgcctgcccctgagagcgat
cctaggtag

KEGG   Homo sapiens (human): 8525Help
Entry
8525              CDS       T01001                                 

Gene name
DGKZ, DAGK5, DAGK6, DGK-ZETA, hDGKzeta
Definition
(RefSeq) diacylglycerol kinase zeta
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    8525 (DGKZ)
   00564 Glycerophospholipid metabolism
    8525 (DGKZ)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8525 (DGKZ)
   04072 Phospholipase D signaling pathway
    8525 (DGKZ)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8525 (DGKZ)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     8525 (DGKZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc DAGK_cat C1_1 Ank_2 Ank_5 Ank_3 Ank_4 Ank
Motif
Other DBs
NCBI-GeneID: 8525
NCBI-ProteinID: NP_001099010
OMIM: 601441
HGNC: 2857
Ensembl: ENSG00000149091
Vega: OTTHUMG00000166437
Pharos: Q13574(Tbio)
UniProt: Q13574
Position
11p11.2
AA seq 1117 aa AA seqDB search
METFFRRHFRGKVPGPGEGQQRPSSVGLPTGKARRRSPAGQASSSLAQRRRSSAQLQGCL
LSCGVRAQGSSRRRSSTVPPSCNPRFIVDKVLTPQPTTVGAQLLGAPLLLTGLVGMNEEE
GVQEDVVAEASSAIQPGTKTPGPPPPRGAQPLLPLPRYLRRASSHLLPADAVYDHALWGL
HGYYRRLSQRRPSGQHPGPGGRRASGTTAGTMLPTRVRPLSRRRQVALRRKAAGPQAWSA
LLAKAITKSGLQHLAPPPPTPGAPCSESERQIRSTVDWSESATYGEHIWFETNVSGDFCY
VGEQYCVARMLKSVSRRKCAACKIVVHTPCIEQLEKINFRCKPSFRESGSRNVREPTFVR
HHWVHRRRQDGKCRHCGKGFQQKFTFHSKEIVAISCSWCKQAYHSKVSCFMLQQIEEPCS
LGVHAAVVIPPTWILRARRPQNTLKASKKKKRASFKRKSSKKGPEEGRWRPFIIRPTPSP
LMKPLLVFVNPKSGGNQGAKIIQSFLWYLNPRQVFDLSQGGPKEALEMYRKVHNLRILAC
GGDGTVGWILSTLDQLRLKPPPPVAILPLGTGNDLARTLNWGGGYTDEPVSKILSHVEEG
NVVQLDRWDLHAEPNPEAGPEDRDEGATDRLPLDVFNNYFSLGFDAHVTLEFHESREANP
EKFNSRFRNKMFYAGTAFSDFLMGSSKDLAKHIRVVCDGMDLTPKIQDLKPQCVVFLNIP
RYCAGTMPWGHPGEHHDFEPQRHDDGYLEVIGFTMTSLAALQVGGHGERLTQCREVVLTT
SKAIPVQVDGEPCKLAASRIRIALRNQATMVQKAKRRSAAPLHSDQQPVPEQLRIQVSRV
SMHDYEALHYDKEQLKEASVPLGTVVVPGDSDLELCRAHIERLQQEPDGAGAKSPTCQKL
SPKWCFLDATTASRFYRIDRAQEHLNYVTEIAQDEIYILDPELLGASARPDLPTPTSPLP
TSPCSPTPRSLQGDAAPPQGEELIEAAKRNDFCKLQELHRAGGDLMHRDEQSRTLLHHAV
STGSKDVVRYLLDHAPPEILDAVEENGETCLHQAAALGQRTICHYIVEAGASLMKTDQQG
DTPRQRAEKAQDTELAAYLENRQHYQMIQREDQETAV
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atggagactttctttaggagacatttccgggggaaggtgccaggccctggagaggggcag
cagcggcccagcagcgtggggctgcccacaggcaaggcccggcgtcgctcccccgctggg
caggcctcctcctcactggcacagcggcgccgctccagcgcccagctccagggctgcctc
ctgagttgcggggtgagggcccagggttccagccgccggcgctccagcactgtgccccct
tcctgcaacccccgcttcatcgtggataaggtgctcactccacagcctaccaccgtgggg
gcccagcttctgggtgcacccctgctgttgaccgggcttgtgggcatgaatgaggaggag
ggtgtccaggaggatgtggtagccgaggcatcgagcgccatccagccaggcaccaagaca
ccagggccacccccacctcggggcgcccagccgctgttgcccctaccccgctacctgcgc
cgagcctcctcccacctgctccccgcggatgccgtatatgaccacgctctctggggcctg
cacggctactatcggcgcctcagccagcggcggccctcaggccagcaccctggccctggg
ggccgaagagcctcaggcaccaccgccggcaccatgctgcccacccgtgtgcgcccactg
tcccgcaggcgccaggtagccctacggcgcaaggcggccggaccccaggcctggagcgcc
ctgctcgcgaaagccatcaccaagtcgggcctccagcacctggccccccctccgcccacc
cctggggccccgtgcagcgagtcagagcggcagatccggagtacagtggactggagcgag
tcagcgacatatggggagcacatctggttcgagaccaacgtgtccggggacttctgctac
gttggggagcagtactgtgtagccaggatgctgaagtcagtgtctcgaagaaagtgcgca
gcctgcaagattgtggtgcacacgccctgcatcgagcagctggagaagataaatttccgc
tgtaagccgtccttccgtgaatcaggctccaggaatgtccgcgagccaacctttgtacgg
caccactgggtacacagacgacgccaggacggcaagtgtcggcactgtgggaagggattc
cagcagaagttcaccttccacagcaaggagattgtggccatcagctgctcgtggtgcaag
caggcataccacagcaaggtgtcctgcttcatgctgcagcagatcgaggagccgtgctcg
ctgggggtccacgcagccgtggtcatcccgcccacctggatcctccgcgcccggaggccc
cagaatactctgaaagcaagcaagaagaagaagagggcatccttcaagaggaagtccagc
aagaaagggcctgaggagggccgctggagacccttcatcatcaggcccaccccctccccg
ctcatgaagcccctgctggtgtttgtgaaccccaagagtgggggcaaccagggtgcaaag
atcatccagtctttcctctggtatctcaatccccgacaagtcttcgacctgagccaggga
gggcccaaggaggcgctggagatgtaccgcaaagtgcacaacctgcggatcctggcgtgc
gggggcgacggcacggtgggctggatcctctccaccctggaccagctacgcctgaagccg
ccaccccctgttgccatcctgcccctgggtactggcaacgacttggcccgaaccctcaac
tggggtgggggctacacagatgagcctgtgtccaagatcctctcccacgtggaggagggg
aacgtggtacagctggaccgctgggacctccacgctgagcccaaccccgaggcagggcct
gaggaccgagatgaaggcgccaccgaccggttgcccctggatgtcttcaacaactacttc
agcctgggctttgacgcccacgtcaccctggagttccacgagtctcgagaggccaaccca
gagaaattcaacagccgctttcggaataagatgttctacgccgggacagctttctctgac
ttcctgatgggcagctccaaggacctggccaagcacatccgagtggtgtgtgatggaatg
gacttgactcccaagatccaggacctgaaaccccagtgtgttgttttcctgaacatcccc
aggtactgtgcgggcaccatgccctggggccaccctggggagcaccacgactttgagccc
cagcggcatgacgacggctacctcgaggtcattggcttcaccatgacgtcgttggccgcg
ctgcaggtgggcggacacggcgagcggctgacgcagtgtcgcgaggtggtgctcaccaca
tccaaggccatcccggtgcaggtggatggcgagccctgcaagcttgcagcctcacgcatc
cgcatcgccctgcgcaaccaggccaccatggtgcagaaggccaagcggcggagcgccgcc
cccctgcacagcgaccagcagccggtgccagagcagttgcgcatccaggtgagtcgcgtc
agcatgcacgactatgaggccctgcactacgacaaggagcagctcaaggaggcctctgtg
ccgctgggcactgtggtggtcccaggagacagtgacctagagctctgccgtgcccacatt
gagagactccagcaggagcccgatggtgctggagccaagtccccgacatgccagaaactg
tcccccaagtggtgcttcctggacgccaccactgccagccgcttctacaggatcgaccga
gcccaggagcacctcaactatgtgactgagatcgcacaggatgagatttatatcctggac
cctgagctgctgggggcatcggcccggcctgacctcccaacccccacttcccctctcccc
acctcaccctgctcacccacgccccggtcactgcaaggggatgctgcaccccctcaaggt
gaagagctgattgaggctgccaagaggaacgacttctgtaagctccaggagctgcaccga
gctgggggcgacctcatgcaccgagacgagcagagtcgcacgctcctgcaccacgcagtc
agcactggcagcaaggatgtggtccgctacctgctggaccacgcccccccagagatcctt
gatgcggtggaggaaaacggggagacctgtttgcaccaagcagcggccctgggccagcgc
accatctgccactacatcgtggaggccggggcctcgctcatgaagacagaccagcagggc
gacactccccggcagcgggctgagaaggctcaggacaccgagctggccgcctacctggag
aaccggcagcactaccagatgatccagcgggaggaccaggagacggctgtgtag

KEGG   Homo sapiens (human): 8526Help
Entry
8526              CDS       T01001                                 

Gene name
DGKE, AHUS7, DAGK5, DAGK6, DGK, NPHS7
Definition
(RefSeq) diacylglycerol kinase epsilon
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa05231  Choline metabolism in cancer
Disease
H01657  Nephrotic syndrome
H01726  Membranoproliferative glomerulonephritis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    8526 (DGKE)
   00564 Glycerophospholipid metabolism
    8526 (DGKE)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8526 (DGKE)
   04072 Phospholipase D signaling pathway
    8526 (DGKE)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8526 (DGKE)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     8526 (DGKE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc DAGK_cat C1_1
Motif
Other DBs
NCBI-GeneID: 8526
NCBI-ProteinID: NP_003638
OMIM: 601440
HGNC: 2852
Ensembl: ENSG00000153933
Vega: OTTHUMG00000178121
Pharos: P52429(Tbio)
UniProt: P52429 A1L4Q0
Position
17q22
AA seq 567 aa AA seqDB search
MEAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHRRDIFRKSKH
GWRDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLRKADKRFQCKEIMLKNDTKVL
DAMPHHWIRGNVPLCSYCMVCKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNEKCDFG
EFKNLIIPPSYLTSINQMRKDKKTDYEVLASKLGKQWTPLIILANSRSGTNMGEGLLGEF
RILLNPVQVFDVTKTPPIKALQLCTLLPYYSARVLVCGGDGTVGWVLDAVDDMKIKGQEK
YIPQVAVLPLGTGNDLSNTLGWGTGYAGEIPVAQVLRNVMEADGIKLDRWKVQVTNKGYY
NLRKPKEFTMNNYFSVGPDALMALNFHAHREKAPSLFSSRILNKAVYLFYGTKDCLVQEC
KDLNKKVELELDGERVALPSLEGIIVLNIGYWGGGCRLWEGMGDETYPLARHDDGLLEVV
GVYGSFHCAQIQVKLANPFRIGQAHTVRLILKCSMMPMQVDGEPWAQGPCTVTITHKTHA
MMLYFSGEQTDDDISSTSDQEDIKATE
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggaagcggagaggcggccggcgccgggctcgccctccgagggcctgtttgcggacggg
cacctgatcttgtggacgctgtgctcggtcctgctgccggtgttcatcaccttctggtgt
agcctccagcggtcgcgccggcagctgcaccgcagggacatcttccgcaagagcaagcac
gggtggcgcgacacggacctgttcagccagcccacctactgctgcgtgtgcgcgcagcac
attctgcagggcgccttctgcgactgctgcgggctccgcgtggacgagggctgcctcagg
aaggccgacaagcgcttccagtgcaaggagattatgctcaagaatgacaccaaggtcctg
gacgccatgccccaccactggatccggggcaacgtgcccctgtgcagttactgtatggtt
tgcaagcagcagtgtggctgtcaacccaagctttgcgattacaggtgcatttggtgccag
aaaacagtacatgatgagtgcatgaaaaatagtttaaagaatgaaaaatgtgattttgga
gaattcaaaaacctaatcattccaccaagttatttaacatccattaatcagatgcgtaaa
gacaaaaaaacagattatgaagtgctagcctctaagcttggaaagcagtggaccccatta
ataatcctggccaactctcgtagtggaactaatatgggagaaggactgttgggagaattt
aggatcttgttgaatccagtccaggtttttgatgtaactaaaactcctcctatcaaagcc
ctacaactctgtactcttctcccatattattcagctcgagtacttgtttgtggaggggat
gggactgtagggtgggtcctggatgcagttgatgacatgaagattaagggacaagaaaag
tacattccacaagttgcagttttgcctctgggaacaggcaacgatctatccaatacattg
ggttggggtacaggttatgctggagaaattccagttgcgcaggttttgcgaaatgtaatg
gaagcagatggaattaaactagatcgatggaaagttcaagtaacaaataaaggatactac
aacttaagaaaacccaaggaattcacaatgaacaactatttttctgttggacctgatgct
ctcatggctctcaattttcatgctcatcgtgagaaggcaccatctctgttttctagcaga
attcttaataaggcggtttacttattctatggaaccaaagattgtttagtgcaagaatgt
aaagatttgaataaaaaagttgagctagaactggatggtgagcgagtagcactgcccagc
ttggaaggtattatagttctgaacatcggatactggggcggtggctgcagactatgggaa
gggatgggggacgagacttaccctctagccaggcatgacgatggtctgctggaagtcgtt
ggagtatatgggtctttccactgtgctcagattcaagtaaaactggctaatccttttcga
ataggacaggcacatacagtgaggctgattttgaagtgctccatgatgccaatgcaggtg
gatggggagccttgggcccaagggccctgcactgtcaccataactcacaagacacatgca
atgatgttatatttctctggagaacaaacagatgatgacatctctagtacttcggatcaa
gaagatataaaggcgactgaatag

KEGG   Homo sapiens (human): 8527Help
Entry
8527              CDS       T01001                                 

Gene name
DGKD, DGKdelta, dgkd-2
Definition
(RefSeq) diacylglycerol kinase delta
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    8527 (DGKD)
   00564 Glycerophospholipid metabolism
    8527 (DGKD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    8527 (DGKD)
   04072 Phospholipase D signaling pathway
    8527 (DGKD)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    8527 (DGKD)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     8527 (DGKD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc DAGK_cat SAM_2 C1_1 SAM_1 PH PH_3 PH_8 C1_2 Mcp5_PH PH_11 SAM_PNT SAM_3 SBE2
Motif
Other DBs
NCBI-GeneID: 8527
NCBI-ProteinID: NP_690618
OMIM: 601826
HGNC: 2851
Ensembl: ENSG00000077044
Vega: OTTHUMG00000133290
Pharos: Q16760(Tbio)
UniProt: Q16760
Structure
PDB: 

Position
2q37.1
AA seq 1214 aa AA seqDB search
MAAAAGAPPPGPPQPPPPPPPEESSDSEPEAEPGSPQKLIRKVSTSGQIRQKTIIKEGML
TKQNNSFQRSKRRYFKLRGRTLYYAKTAKSIIFDEVDLTDASVAESSTKNVNNSFTVITP
CRKLILCADNRKEMEDWIAALKTVQNREHFEPTQYSMDHFSGMHNWYACSHARPTYCNVC
REALSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEDADGIAMPHQWLE
GNLPVSAKCTVCDKTCGSVLRLQDWRCLWCKAMVHTSCKESLLTKCPLGLCKVSVIPPTA
LNSIDSDGFWKASCPPSCTSPLLVFVNSKSGDNQGVKFLRRFKQLLNPAQVFDLMNGGPH
LGLRLFQKFDTFRILVCGGDGSVGWVLSEIDSLNLHKQCQLGVLPLGTGNDLARVLGWGS
ACDDDTQLPQILEKLERASTKMLDRWSVMAYEAKLPRQASSSTVTEDFSEDSEVQQILFY
EDSVAAHLSKILTSDQHSVVISSAKVLCETVKDFVARVGKAYEKTTESSEESEVMAKKCS
VLKEKLDSLLKTLDDESQASSSLPNPPPTIAEEAEDGDGSGSICGSTGDRLVASACPARP
QIFRPREQLMLRANSLKKAIRQIIEHTEKAVDEQNAQTQEQEGFVLGLSESEEKMDHRVC
PPLSHSESFGVPKGRSQRKVSKSPCEKLISKGSLSLGSSASLPPQPGSRDGLPALNTKIL
YPNVRAGMSGSLPGGSVISRLLINADPFNSEPETLEYYTEKCVMNNYFGIGLDAKISLDF
NNKRDEHPEKCRSRTKNMMWYGVLGTKELLHRTYKNLEQKVLLECDGRPIPLPSLQGIAV
LNIPSYAGGTNFWGGTKEDDTFAAPSFDDKILEVVAVFGSMQMAVSRVIRLQHHRIAQCR
TVKISILGDEGVPVQVDGEAWVQPPGYIRIVHKNRAQTLTRDRAFESTLKSWEDKQKCEL
PRPPSCSLHPEMLSEEEATQMDQFGQAAGVLIHSIREIAQSHRDMEQELAHAVNASSKSM
DRVYGKPRTTEGLNCSFVLEMVNNFRALRSETELLLSGKMALQLDPPQKEQLGSALAEMD
RQLRRLADTPWLCQSAEPGDEESVMLDLAKRSRSGKFRLVTKFKKEKNNKNKEAHSSLGA
PVHLWGTEEVAAWLEHLSLCEYKDIFTRHDIRGSELLHLERRDLKDLGVTKVGHMKRILC
GIKELSRSAPAVEA
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcgggcgcccctccgccgggtcccccgcaaccgcctccgccgccgccg
cccgaggagtcgtccgacagcgagcccgaggcggagcccggctccccacagaagctcatc
cgcaaggtgtccacgtcgggtcagatccgacagaagaccatcatcaaagaggggatgctg
accaaacagaacaattcattccagcgatcaaaaaggagatactttaagcttcgagggcga
acgctttactatgccaaaacggcaaagtcaatcatatttgatgaggtggatctgacagat
gccagcgtagctgaatccagtaccaaaaacgtcaacaacagttttacggtcataactcca
tgcaggaagctcatcttgtgtgctgataacagaaaagaaatggaagattggattgcagca
ttaaagactgtgcagaacagggagcactttgagcccacccagtacagcatggaccacttc
tcagggatgcacaattggtacgcctgttcccacgcgaggccgacctactgcaatgtgtgc
cgtgaggctctgtctggggtcacgtcgcacgggctgtcctgcgaggtgtgcaaatttaag
gcccacaagcgctgtgctgtgcgtgcaaccaataactgcaagtggaccacactggcctcg
atcgggaaggacatcattgaagatgcagatgggattgcaatgccccaccagtggttggaa
ggaaacctacctgtgagcgccaagtgcactgtgtgcgacaagacctgtggcagtgtgctg
cgcctgcaggactggcgctgcctctggtgcaaggccatggttcacacatcgtgtaaagaa
tccttgctgaccaagtgcccacttggcctgtgcaaagtgtcagtcatcccacccacggct
ctcaacagcatcgactccgatgggttctggaaggccagctgtcctccttcttgcacaagc
ccactgttggtcttcgtcaattcaaaaagtggggacaaccagggtgtgaagttcctcaga
agattcaaacagctactaaaccccgcccaggtcttcgacctcatgaacggaggcccacac
ctcggcttacggttattccagaagtttgacacattccggattctggtttgtggcggggat
ggaagtgttggctgggtcctctccgaaatcgacagcctcaaccttcataaacagtgtcag
ctgggagtgctgccgctcggcacagggaacgacttggcccgagtactgggctggggctca
gcctgcgatgacgacacccagctcccccagatcttggagaagttggagagagccagcacc
aagatgctggacaggtggagcgtcatggcatacgaggccaagctcccccggcaggcctcc
tcctctaccgtcaccgaagacttcagcgaggattccgaggtacagcagattctcttctat
gaagactcggttgcagcccacctttctaaaatcctcacctcggaccagcactcggtggtc
atctcctcggccaaagtgctctgtgagacggtgaaggacttcgtggcacgggtggggaag
gcctatgagaagacgaccgagagctcggaggagtcagaggtcatggccaagaagtgctct
gtcctgaaagagaagctggattcccttctcaagaccttggacgatgagtcccaggcctcg
tcctctctgcccaacccgccccccaccattgccgaggaggctgaagatggagatgggtcg
ggcagcatctgcggttccaccggagaccgcttggtggcatcagcttgcccggcccggccg
cagatattccggcctcgagaacagctcatgctgagagccaacagcctgaagaaagcaatt
cgtcagatcatagaacacacagaaaaagctgtcgatgagcagaatgcccagacccaggag
caggagggcttcgtcctgggcctctctgagtcagaggagaagatggaccacagagtgtgc
ccaccactgtcccacagcgagagcttcggggtccccaaggggaggagccagcgcaaagtg
tcgaaatctccgtgtgaaaagctgatcagcaaagggagtctgtccctaggcagttctgct
tcccttccgccccagccgggaagccgggacggcctgcctgcgctcaacaccaagatcctg
tacccaaatgtccgggctggaatgtctggttccttacccggtggctcagtcatcagtcgc
ctgttaattaatgctgatcccttcaactctgaaccagaaaccctagagtattacacggag
aaatgtgtcatgaacaactattttggcattggcctggatgcgaagatatccctggacttt
aacaacaagcgcgatgagcacccagagaagtgcaggagccgaaccaagaacatgatgtgg
tatggagttcttggaaccaaagagttgctgcacagaacctacaagaacctggagcaaaag
gtcttgctggagtgtgacgggcgacccatcccactccccagtcttcagggaattgctgtc
cttaacattcccagctatgccggaggaaccaacttctgggggggtaccaaggaagatgat
actttcgcagctccatcattcgatgacaagattctggaggtggtcgccgtgttcggcagc
atgcagatggccgtctctcgagtcatcaggctacagcatcatcggatcgcccagtgtcgc
acggtgaagatctccatccttggggatgagggcgtgcctgtgcaggtggacggagaggcc
tgggtccagccgccagggtacattcggattgtccacaagaaccgggcacagacactgacc
agagacagggcatttgagagcaccctgaagtcctgggaagacaagcagaagtgcgagctg
ccccgccctccatcctgttccctgcacccggagatgctgtccgaggaggaggccacccag
atggaccagtttgggcaggcagcaggggtcctcattcacagtatccgagaaatagctcag
tctcaccgggacatggagcaggaactggcccacgccgtcaatgccagctccaagtccatg
gaccgtgtgtatggcaagcccagaaccacagaggggctcaactgcagcttcgtcctggaa
atggtgaataacttcagagctctgcgcagtgagacggagctgctgctgtctgggaagatg
gccctgcagctggatccgcctcagaaggagcagctggggagtgctcttgccgagatggac
cgacagctcaggaggctggcagacaccccgtggctctgccagtccgcagagcccggcgac
gaagagagtgtgatgctggatcttgccaagcgcagtcgcagtggtaaattccgcctcgtg
accaagtttaaaaaggagaaaaacaacaagaacaaagaagctcacagtagcctgggagcc
ccggttcacctctgggggacagaggaggttgctgcctggctggagcacctcagtctctgt
gagtataaggacatcttcacacggcacgacatccggggctctgagctcctgcacctggag
cggagggacctcaaggacctgggcgtgaccaaggtgggccacatgaagaggatcctgtgt
ggcatcaaggagctgagccgcagcgcccccgccgtcgaggcctag

KEGG   Homo sapiens (human): 9162Help
Entry
9162              CDS       T01001                                 

Gene name
DGKI, DGK-IOTA
Definition
(RefSeq) diacylglycerol kinase iota
  KO
K00901  diacylglycerol kinase (ATP) [EC:2.7.1.107]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa00564  Glycerophospholipid metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04072  Phospholipase D signaling pathway
hsa05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    9162 (DGKI)
   00564 Glycerophospholipid metabolism
    9162 (DGKI)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    9162 (DGKI)
   04072 Phospholipase D signaling pathway
    9162 (DGKI)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    9162 (DGKI)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.107  diacylglycerol kinase (ATP)
     9162 (DGKI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_acc DAGK_cat C1_1 Ank_2 Ank_3 Ank_5 Ank_4 Ank
Motif
Other DBs
NCBI-GeneID: 9162
NCBI-ProteinID: NP_004708
OMIM: 604072
HGNC: 2855
Ensembl: ENSG00000157680
Vega: OTTHUMG00000155697
Pharos: O75912(Tbio)
UniProt: O75912
Position
7q33
AA seq 1065 aa AA seqDB search
MDAAGRGCHLLPLPAARGPARAPAAAAAAAASPPGPCSGAACAPSAAAGAGAMNPSSSAG
EEKGATGGSSSSGSGAGSCCLGAEGGADPRGAGSAAAAGAAALDEPAAAGQKEKDEALEE
KLRNLTFRKQVSYRKAISRAGLQHLAPAHPLSLPVANGPAKEPRATLDWSENAVNGEHLW
LETNVSGDLCYLGEENCQVRFAKSALRRKCAVCKIVVHTACIEQLEKINFRCKPTFREGG
SRSPRENFVRHHWVHRRRQEGKCKQCGKGFQQKFSFHSKEIVAISCSWCKQAFHNKVTCF
MLHHIEEPCSLGAHAAVIVPPTWIIKVKKPQNSLKASNRKKKRTSFKRKASKRGMEQENK
GRPFVIKPISSPLMKPLLVFVNPKSGGNQGTKVLQMFMWYLNPRQVFDLSQEGPKDALEL
YRKVPNLRILACGGDGTVGWILSILDELQLSPQPPVGVLPLGTGNDLARTLNWGGGYTDE
PVSKILCQVEDGTVVQLDRWNLHVERNPDLPPEELEDGVCKLPLNVFNNYFSLGFDAHVT
LEFHESREANPEKFNSRFRNKMFYAGAAFSDFLQRSSRDLSKHVKVVCDGTDLTPKIQEL
KFQCIVFLNIPRYCAGTMPWGNPGDHHDFEPQRHDDGYIEVIGFTMASLAALQVGGHGER
LHQCREVMLLTYKSIPMQVDGEPCRLAPAMIRISLRNQANMVQKSKRRTSMPLLNDPQSV
PDRLRIRVNKISLQDYEGFHYDKEKLREASISDWLRTIAGELVQSFGAIPLGILVVRGDC
DLETCRMYIDRLQEDLQSVSSGSQRVHYQDHETSFPRALSAQRLSPRWCFLDDRSQEHLH
FVMEISQDEIFILDPDMVVSQPAGTPPGMPDLVVEQASGISDWWNPALRKRMLSDSGLGM
IAPYYEDSDLKDLSHSRVLQSPVSSEDHAILQAVIAGDLMKLIESYKNGGSLLIQGPDHC
SLLHYAAKTGNGEIVKYILDHGPSELLDMADSETGETALHKAACQRNRAVCQLLVDAGAS
LRKTDSKGKTPQERAQQAGDPDLAAYLESRQNYKVIGHEDLETAV
NT seq 3198 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgcgggaaggggctgccatttgctgcccctgccagcggcgcgcggacctgcc
cgcgctcctgcagccgccgccgccgccgccgccagcccgcccggcccctgcagcggcgcc
gcctgcgctccctccgcggccgccggagcgggcgccatgaaccccagctcctcggcggga
gaggagaaaggggcgacgggcggcagcagcagcagcggaagcggcgccgggagctgctgc
ctgggcgccgagggcggcgcggacccgcggggcgcagggtcagccgcggcggcgggggcc
gctgccctggacgagcccgcggccgccggccagaaggagaaggacgaagcgctggaggag
aagctgaggaacttaactttccggaagcaggtctcgtacaggaaagcaatctcccgggca
ggcctccagcatctggctcctgcacatcccctcagccttcctgtggcaaatggtccagcc
aaggagcccagagcgactttggactggagtgagaatgccgtgaatggagaacacctgtgg
ctggagaccaacgtctcgggagacctctgctaccttggagaggagaactgccaagtcaga
tttgcaaaatcagctctcaggaggaagtgtgcagtctgtaaaatcgtcgtccacaccgcc
tgcattgagcagctagaaaagattaatttcagatgtaaaccaacatttcgagaaggaggc
tcaaggtcaccaagagaaaattttgtacgtcatcactgggtgcacaggcgtcggcaggag
gggaaatgtaagcagtgtggtaagggcttccagcaaaagttctccttccacagtaaagag
attgtggctatcagctgttcctggtgcaagcaggcgtttcacaataaggtgacctgcttc
atgctgcatcacattgaagaaccctgctccctgggggctcatgctgctgttattgtcccg
cccacttggatcattaaggtgaagaaacctcagaactccctgaaggcttcaaatcggaag
aagaagagaacaagctttaaaagaaaagccagtaaaagagggatggaacaggaaaacaaa
ggtcgtccttttgtgataaaacccatctcttctcctctcatgaaacccttgcttgtattt
gtgaatcccaagagtggaggcaaccagggaaccaaagtcctgcagatgttcatgtggtac
ctgaatccacggcaagtctttgatctttctcaggaagggccaaaagatgcgcttgaattg
tataggaaagtaccaaatctgcgaattctggcctgtggtggggatggaacggtgggctgg
atcctttccatcctggatgaactgcagctgagccctcagcctcctgtgggggtccttcct
ctggggactgggaatgacctggctcgaactctcaactggggagggggctacactgatgaa
cctgtttctaagatcctgtgtcaagtggaagatgggacagttgtacagctagatcgctgg
aacctccatgtggaaagaaaccccgacttgcctccagaagaacttgaagatggcgtatgt
aagctccctctgaatgttttcaataactacttcagccttggatttgatgcccatgtcaca
ctggagttccatgaatccagagaagcaaatccagagaaattcaacagtcgttttcgaaat
aaaatgttctatgcaggggcagctttttctgacttcctacagagaagttctagagatcta
tccaaacatgttaaagttgtttgtgatggaacagatctcaccccaaagattcaggaactg
aagttccagtgtatagtatttttaaatatacccagatattgtgctggcacaatgccctgg
ggaaacccaggtgatcaccatgatttcgaacctcagcgtcatgatgatggttatattgaa
gtcattggatttaccatggcctctttggcagccctgcaagttgggggccatggagagagg
ctacaccagtgtcgagaagtcatgcttctaacttacaaatccatccccatgcaagtggat
ggggagccctgtaggttggccccagctatgattcggatctccctgaggaatcaggccaac
atggtacagaagagcaagaggagaacatccatgcctttactcaatgatccccagtctgtc
ccagatcgtctgaggatccgggtgaacaaaatcagtttacaagactatgaaggattccac
tatgacaaggagaaactccgagaagcttctatttcagactggttaagaaccattgctggg
gaactagtgcagtcatttggagcgatacctctgggtattctagttgtgcgtggagactgt
gatttggagacttgccgtatgtacatagaccgcctacaggaggacctacagtcagtttct
tctggctcccagagagttcattaccaggaccatgaaacctccttccccagggctctctca
gcacagaggctctctcctcggtggtgcttcctagatgacagatctcaggaacatttgcac
tttgtgatggagatttcccaagatgagatttttattctggacccagatatggtggtgtca
cagccggcggggacacctccgggcatgcctgacctggtggtggaacaagcctcggggatc
tcagactggtggaatcctgccctgcggaaacgcatgctgagtgacagtgggctggggatg
atagctccctattatgaggactcagatctgaaagatctcagccactcccgcgtgctacag
tcaccagtctcttcagaagatcatgcaattttgcaggcagtaatagctggtgatcttatg
aagctaatagaaagctataaaaatggaggcagtctgctaattcagggaccagaccactgt
tcactccttcactacgcagctaaaaccggcaacggggagattgtgaaatatatccttgac
cacggaccttccgagttattggatatggcagacagtgaaacgggtgagactgcactgcac
aaggctgcctgccagcggaaccgggctgtgtgccagcttctggtggatgcaggagcatct
ctgagaaagacggactccaagggtaagacacctcaagaaagagcacagcaggctggggac
ccagacttggctgcttacctagaaagccgtcagaactataaggtcattggccatgaggac
ctggaaactgctgtttga

DBGET integrated database retrieval system