KEGG   Homo sapiens (human): 139212Help
Entry
139212            CDS       T01001                                 

Gene name
PIH1D3, CILD36, CXorf41, DNAAF6, NYSAR97, TWISTER
Definition
(RefSeq) PIH1 domain containing 3
Organism
hsa  Homo sapiens (human)
Disease
H00564  Primary ciliary dyskinesia
SSDB OrthologParalogGFIT
Motif
Pfam: PIH1_CS ArsA_HSP20
Motif
Other DBs
NCBI-GeneID: 139212
NCBI-ProteinID: NP_001162625
OMIM: 300933
HGNC: 28570
Ensembl: ENSG00000080572
Vega: OTTHUMG00000022160
Pharos: Q9NQM4(Tdark)
UniProt: Q9NQM4
Position
Xq22.3
AA seq 214 aa AA seqDB search
MESENMDSENMKTENMESQNVDFESVSSVTALEALSKLLNPEEEDDSDYGQTNGLSTIGA
MGPGNIGPPQIEELKVIPETSEENNEDIWNSEEIPEGAEYDDMWDVREIPEYEIIFRQQV
GTEDIFLGLSKKDSSTGCCSELVAKIKLPNTNPSDIQIDIQETILDLRTPQKKLLITLPE
LVECTSAKAFYIPETETLEITMTMKRELDIANFF
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atggaatctgaaaatatggattctgaaaatatgaagacagaaaatatggaatctcaaaat
gtagactttgagagtgtttcttcagttacagctctggaagccctctctaagctacttaat
cctgaagaagaggatgattctgactatggacagacaaatggtttatctactattggagcc
atgggtcctgggaatattggaccaccccaaatagaagagctcaaagtcatccctgaaacc
agcgaggaaaataatgaggacatctggaattcagaagagattccagaaggagcagaatat
gatgatatgtgggatgttagagaaatcccagagtatgagattatattcagacagcaggtg
ggaactgaagatatatttttagggttgtcaaaaaaggactcctcaacaggttgttgcagt
gaactagtggctaaaattaaattgccaaatacaaacccttctgatattcaaattgatatc
caggaaacaatccttgaccttcgtactcctcagaagaagctgttgataactcttcctgag
ctggtggaatgtaccagtgccaaagcattctatatcccagagactgaaactcttgaaatc
actatgactatgaaaagagagttagatattgctaatttcttctga

DBGET integrated database retrieval system